Overview

  • Product name

  • Description

    Rabbit polyclonal to ADAMTS12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human ADAMTS12 aa 310-360 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    IVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLLTRKDICAGFNRPCE T


    Database link: P58397

  • Positive control

    • Human lung carcinoma and colon carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB 1/100 - 1/1000. Predicted molecular weight: 178 kDa.

Target

  • Relevance

    This protein is a disintegrin and metalloproteinase with thrombospondin motifs 12 (ADAMTS12), which is a member of the ADAMTS protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin like domain, and a thrombospondin type 1 (TS 1) motif. Individual members of this family differ in the number of C terminal TS 1 motifs, and some have unique C terminal domains. The enzyme encoded by this gene contains 8 TS 1 motifs. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • A disintegrin and metalloproteinase with thrombospondin motifs 12 antibody
    • A disintegrin like and metalloprotease with thrombospondin type 1 motif 12 antibody
    • ADAM metallopeptidase with thrombospondin type 1 motif 12 antibody
    • ADAM TS 12 antibody

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded Human colon carcinoma tissue labeling ADAMTS12 with ab203102 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded Human lung carcinoma tissue labeling ADAMTS12 with ab203102 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up