Overview

  • Product name

  • Description

    Rabbit polyclonal to ADAMTS5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat ADAMTS5 aa 267-622. (Expressed in E.coli).
    Sequence:

    RQVELLLVADSSMAKMYGRGLQHYLLTLASIANRLYSHASIENHIRLAVV KVVVLTDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYDAAILFTRE DLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGL SHDDSKFCEENFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGH GNCLLDVPRKQILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLW CAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKKYYSTSSHG NWGSWGPWGQCSRSCGGGVQFAYRHCNNPAPRNSGRYCTGKRAIYRSCSV IPCPPN


    Database link: Q6TY19

  • Positive control

    • WB: Human A549 and HeLa cell lysates; recombinant rat ADAMTS5 protein. IHC-P: Ovary tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 102 kDa.

Target

  • Function

    Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. May play a role in proteolytic processing mostly during the peri-implantation period.
  • Tissue specificity

    Expressed at low level in placenta primarily but also detected in heart and brain, cervix, uterus, bladder, esophagus, rib cartilage, chondroblastoma, fibrous tissue and a joint capsule from an arthritic patient.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 2 TSP type-1 domains.
  • Domain

    The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • A disintegrin and metalloproteinase with thrombospondin motifs 11 antibody
    • A disintegrin and metalloproteinase with thrombospondin motifs 5 antibody
    • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 5 antibody
    • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase 2) antibody
    • A disintegrin-like and metalloprotease with thrombospondin type 1 motif, 5 antibody
    • A Disintigrin And Metalloproteinase with ThromboSpondin motif-5 antibody
    • ADAM metallopeptidase with thrombospondin type 1 motif 5 antibody
    • ADAM TS 11 antibody
    • ADAM TS 5 antibody
    • ADAM TS5 antibody
    • ADAM-TS 11 antibody
    • ADAM-TS 5 antibody
    • ADAM-TS5 antibody
    • ADAMTS 11 antibody
    • ADAMTS 5 antibody
    • ADAMTS-11 antibody
    • ADAMTS-5 antibody
    • ADAMTS11 antibody
    • ADAMTS11, formerly antibody
    • Adamts5 antibody
    • ADMP 2 antibody
    • ADMP-2 antibody
    • ADMP2 antibody
    • Aggrecanase 2 antibody
    • Aggrecanase-2 antibody
    • ATS5_HUMAN antibody
    • FLJ36738 antibody
    • Implantin antibody
    • ThromboSpondin motif-5 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat ovary tissue stained for ADAMST5 using ab231595 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ADAMTS5 antibody (ab231595) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 102 kDa

  • Anti-ADAMTS5 antibody (ab231595) at 2 µg/ml + A549 (Human lung carcinoma cell line) cell lysate

    Predicted band size: 102 kDa

  • Anti-ADAMTS5 antibody (ab231595) at 2 µg/ml + Recombinant rat ADAMTS5 protein

    Predicted band size: 102 kDa

References

This product has been referenced in:

  • Wang T  et al. Long non-coding RNA XIST promotes extracellular matrix degradation by functioning as a competing endogenous RNA of miR-1277-5p in osteoarthritis. Int J Mol Med 44:630-642 (2019). Read more (PubMed: 31198977) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up