Anti-ADAMTS5 antibody (ab246975)
Key features and details
- Rabbit polyclonal to ADAMTS5
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ADAMTS5 antibody
See all ADAMTS5 primary antibodies -
Description
Rabbit polyclonal to ADAMTS5 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow -
Immunogen
Recombinant fragment corresponding to Human ADAMTS5 aa 419-496.
Sequence:SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGH GNCLLDLPRKQILGPEELPGQTYDATQQ
Database link: Q9UNA0 -
Positive control
- ICC/IF: RH-30 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab246975 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. May play a role in proteolytic processing mostly during the peri-implantation period. -
Tissue specificity
Expressed at low level in placenta primarily but also detected in heart and brain, cervix, uterus, bladder, esophagus, rib cartilage, chondroblastoma, fibrous tissue and a joint capsule from an arthritic patient. -
Sequence similarities
Contains 1 disintegrin domain.
Contains 1 peptidase M12B domain.
Contains 2 TSP type-1 domains. -
Domain
The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. -
Post-translational
modificationsThe precursor is cleaved by a furin endopeptidase. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 286805 Cow
- Entrez Gene: 11096 Human
- Entrez Gene: 23794 Mouse
- Omim: 605007 Human
- SwissProt: Q9TT92 Cow
- SwissProt: Q9UNA0 Human
- SwissProt: Q9R001 Mouse
- Unigene: 58324 Human
see all -
Alternative names
- A disintegrin and metalloproteinase with thrombospondin motifs 11 antibody
- A disintegrin and metalloproteinase with thrombospondin motifs 5 antibody
- A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 5 antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab246975 has been referenced in 1 publication.
- Kazakevych J et al. Smarcad1 mediates microbiota-induced inflammation in mouse and coordinates gene expression in the intestinal epithelium. Genome Biol 21:64 (2020). PubMed: 32160911