Anti-ADAMTS5 antibody (ab246975)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ADAMTS5 antibody
See all ADAMTS5 primary antibodies -
Description
Rabbit polyclonal to ADAMTS5 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow
-
Immunogen
Recombinant fragment corresponding to Human ADAMTS5 aa 419-496.
Sequence:SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGH GNCLLDLPRKQILGPEELPGQTYDATQQ
Database link: Q9UNA0 -
Positive control
- ICC/IF: RH-30 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab246975 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. May play a role in proteolytic processing mostly during the peri-implantation period. -
Tissue specificity
Expressed at low level in placenta primarily but also detected in heart and brain, cervix, uterus, bladder, esophagus, rib cartilage, chondroblastoma, fibrous tissue and a joint capsule from an arthritic patient. -
Sequence similarities
Contains 1 disintegrin domain.
Contains 1 peptidase M12B domain.
Contains 2 TSP type-1 domains. -
Domain
The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. -
Post-translational
modificationsThe precursor is cleaved by a furin endopeptidase. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 286805 Cow
- Entrez Gene: 11096 Human
- Entrez Gene: 23794 Mouse
- Omim: 605007 Human
- SwissProt: Q9TT92 Cow
- SwissProt: Q9UNA0 Human
- SwissProt: Q9R001 Mouse
- Unigene: 58324 Human
see all -
Alternative names
- A disintegrin and metalloproteinase with thrombospondin motifs 11 antibody
- A disintegrin and metalloproteinase with thrombospondin motifs 5 antibody
- A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 5 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-ADAMTS5 antibody (ab246975)PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for ADAMST5 (green) using ab246975 at 4 μg/ml in ICC/IF.
Datasheets and documents
References
ab246975 has not yet been referenced specifically in any publications.
