For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    adamts5-antibody-ab246975.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Proteins Aggrecan
Share by email

Anti-ADAMTS5 antibody (ab246975)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-ADAMTS5 antibody (ab246975)

    Key features and details

    • Rabbit polyclonal to ADAMTS5
    • Suitable for: ICC/IF
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Recombinant human ADAMTS5 protein (ab134432)
    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-ADAMTS5 antibody
      See all ADAMTS5 primary antibodies
    • Description

      Rabbit polyclonal to ADAMTS5
    • Host species

      Rabbit
    • Tested applications

      Suitable for: ICC/IFmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Cow
    • Immunogen

      Recombinant fragment corresponding to Human ADAMTS5 aa 419-496.
      Sequence:

      SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGH GNCLLDLPRKQILGPEELPGQTYDATQQ


      Database link: Q9UNA0
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • ICC/IF: RH-30 cells.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.20
      Preservative: 0.02% Sodium azide
      Constituents: 40% Glycerol (glycerin, glycerine), PBS
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Signal Transduction
      • Cytoskeleton / ECM
      • Extracellular Matrix
      • ECM Proteins
      • Aggrecan
      • Signal Transduction
      • Cytoskeleton / ECM
      • Extracellular Matrix
      • ECM Enzymes
      • MMP
      • Signal Transduction
      • Cytoskeleton / ECM
      • Extracellular Matrix
      • ECM Enzymes
      • ADAM Protein Family
      • Cell Biology
      • Proteolysis / Ubiquitin
      • Proteolytic enzymes
      • Metalloprotease
      • ADAM TS

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Recombinant Protein

      • Recombinant human ADAMTS5 protein (ab134432)

    Applications

    Our Abpromise guarantee covers the use of ab246975 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    ICC/IF Use a concentration of 0.25 - 2 µg/ml.

    Fixation/Permeabilization: PFA/Triton X-100.

    Target

    • Function

      Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. May play a role in proteolytic processing mostly during the peri-implantation period.
    • Tissue specificity

      Expressed at low level in placenta primarily but also detected in heart and brain, cervix, uterus, bladder, esophagus, rib cartilage, chondroblastoma, fibrous tissue and a joint capsule from an arthritic patient.
    • Sequence similarities

      Contains 1 disintegrin domain.
      Contains 1 peptidase M12B domain.
      Contains 2 TSP type-1 domains.
    • Domain

      The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
      The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
    • Post-translational
      modifications

      The precursor is cleaved by a furin endopeptidase.
    • Cellular localization

      Secreted > extracellular space > extracellular matrix.
    • Target information above from: UniProt accession Q9UNA0 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 286805 Cow
      • Entrez Gene: 11096 Human
      • Entrez Gene: 23794 Mouse
      • Omim: 605007 Human
      • SwissProt: Q9TT92 Cow
      • SwissProt: Q9UNA0 Human
      • SwissProt: Q9R001 Mouse
      • Unigene: 58324 Human
      • Unigene: 112933 Mouse
      • Unigene: 437478 Mouse
      see all
    • Alternative names

      • A disintegrin and metalloproteinase with thrombospondin motifs 11 antibody
      • A disintegrin and metalloproteinase with thrombospondin motifs 5 antibody
      • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 5 antibody
      • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase 2) antibody
      • A disintegrin-like and metalloprotease with thrombospondin type 1 motif, 5 antibody
      • A Disintigrin And Metalloproteinase with ThromboSpondin motif-5 antibody
      • ADAM metallopeptidase with thrombospondin type 1 motif 5 antibody
      • ADAM TS 11 antibody
      • ADAM TS 5 antibody
      • ADAM TS5 antibody
      • ADAM-TS 11 antibody
      • ADAM-TS 5 antibody
      • ADAM-TS5 antibody
      • ADAMTS 11 antibody
      • ADAMTS 5 antibody
      • ADAMTS-11 antibody
      • ADAMTS-5 antibody
      • ADAMTS11 antibody
      • ADAMTS11, formerly antibody
      • Adamts5 antibody
      • ADMP 2 antibody
      • ADMP-2 antibody
      • ADMP2 antibody
      • Aggrecanase 2 antibody
      • Aggrecanase-2 antibody
      • ATS5_HUMAN antibody
      • FLJ36738 antibody
      • Implantin antibody
      • ThromboSpondin motif-5 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-ADAMTS5 antibody (ab246975)
      Immunocytochemistry/ Immunofluorescence - Anti-ADAMTS5 antibody (ab246975)

      PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for ADAMST5 (green) using ab246975 at 4 μg/ml in ICC/IF.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab246975? Please let us know so that we can cite the reference in this datasheet.

    ab246975 has been referenced in 1 publication.

    • Kazakevych J  et al. Smarcad1 mediates microbiota-induced inflammation in mouse and coordinates gene expression in the intestinal epithelium. Genome Biol 21:64 (2020). PubMed: 32160911

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab246975.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.