Overview

  • Product name

  • Description

    Rabbit polyclonal to ADAMTS7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ADAMTS7 aa 1325-1375.
    Sequence:

    WDLQTVAVWGTFLPTTLTGLGHTPEPALNPGPKGQPESLSPEVPLSSRLL SM


    Database link: Q9UKP4

  • Positive control

    • ICC/IF: U-2 OS (human bone osteosarcoma epithelial cell line) cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Metalloprotease that may play a role in the degradation of COMP.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Detected in meniscus, bone, tendon, cartilage, synovium, fat and ligaments.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 1 PLAC domain.
    Contains 8 TSP type-1 domains.
  • Domain

    The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    N-glycosylated. Can be O-fucosylated by POFUT2 on a serine or a threonine residue found within the consensus sequence C1-X(2)-(S/T)-C2-G of the TSP type-1 repeat domains where C1 and C2 are the first and second cysteine residue of the repeat, respectively. Fucosylated repeats can then be further glycosylated by the addition of a beta-1,3-glucose residue by the glucosyltransferase, B3GALTL. Fucosylation mediates the efficient secretion of ADAMTS family members. Also can be C-glycosylated with one or two mannose molecules on tryptophan residues within the consensus sequence W-X-X-W of the TPRs. N- and C-glycosylations can also facilitate secretion. O-glycosylated proteoglycan. Contains chondroitin sulfate.
    May be cleaved by a furin endopeptidase (By similarity). The precursor is sequentially processed.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix. Also found associated with the external cell surface.
  • Information by UniProt
  • Database links

  • Alternative names

    • A disintegrin and metalloprotease with thrombospondin motifs 7 preproprotein antibody
    • A disintegrin and metalloproteinase with thrombospondin motifs 7 antibody
    • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 7 antibody
    • A disintegrin like and metalloprotease with thrombospondin type 1 motif 7 antibody
    • ADAM metallopeptidase with thrombospondin type 1 motif 7 antibody
    • ADAM metallopeptidase with thrombospondin type 1 motif 7 preproprotein antibody
    • ADAM TS 7 antibody
    • ADAM TS7 antibody
    • ADAM-TS 7 antibody
    • ADAM-TS7 antibody
    • ADAMTS 7 antibody
    • ADAMTS-7 antibody
    • Adamts7 antibody
    • ATS7_HUMAN antibody
    • COMPase antibody
    • DKFZp434H204 antibody
    see all

Images

  • PFA fixed / Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ADAMTS7 (green) using ab222383 at 4 µg/ml in ICC/IF.

References

ab222383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up