Overview

  • Product name

  • Description

    Rabbit polyclonal to ADAMTSL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ADAMTSL4 aa 599-704.
    Sequence:

    ISSPPPILENPTPEPPVPQLQPEILRVEPPLAPAPRPARTPGTLQRQVRI PQMPAPPHPRTPLGSPAAYWKRVGHSACSASCGKGVWRPIFLCISRESGE ELDERS


    Database link: Q6UY14

  • Positive control

    • IHC-P: Human placenta tissue. WB: BEWO cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab223728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 117 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ADAMTSL4 is a member of ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs)-like family and has seven thrombospondin type 1 repeats. The thrombospondin type 1 repeat domain is found in many proteins with diverse biological functions including cellular adhesion, angiogenesis, and patterning of the developing nervous system. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. ADAMTSL4 is involved in the positive regulation of apoptosis.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • ADAMTS like 4 antibody
    • ADAMTS like protein 4 antibody
    • ADAMTSL 4 antibody
    • MGC116260 antibody
    • MGC28749 antibody
    • OTTHUMP00000032789 antibody
    • OTTHUMP00000032790 antibody
    • Thrombospondin repeat containing 1 antibody
    • thrombospondin repeat protein 1 antibody
    • TSRC1 antibody
    see all

Images

  • Paraffin embedded human placenta tissue stained for ADAMTSL4 with ab223728 (1/50 dilution) in immunohistochemical analysis.

  • Anti-ADAMTSL4 antibody (ab223728) at 1/500 dilution + BEWO cell lysate

    Predicted band size: 117 kDa

References

ab223728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up