Anti-ADAR1 antibody (ab16138)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-ADAR1 antibody
See all ADAR1 primary antibodies -
DescriptionSheep polyclonal to ADAR1
-
Host speciesSheep
-
Tested applicationsSuitable for: WBmore details
-
Species reactivityReacts with: Rat
Predicted to work with: Mouse, Human
-
Immunogen
Fusion protein: SFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEK NFYLCPVPND, corresponding to amino acids 1116-1176 of Rat ADAR1. The fusion protein was constructed in the pGEX-KG vector by inserting a fragment corresponding to nucleotides +3346 through +3525 of ADAR1 at the XbaI and XhoI sites in the vector.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
-
Storage bufferPreservative: 0.08% Sodium azide
Constituent: PBS -
Concentration information loading... -
PurityImmunogen affinity purified
-
Purification notesPurified by Ammonium sulfate precipitation. This antibody is provided as a 0.2µm sterile filtered solution.
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab16138 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000. Predicted molecular weight: 136 kDa. |
Target
-
FunctionConverts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site-selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression.
-
Tissue specificityUbiquitously expressed, highest levels were found in brain and lung.
-
Involvement in diseaseDefects in ADAR are a cause of dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]; also known as reticulate acropigmentation of Dohi. DSH is a pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet.
-
Sequence similaritiesContains 1 A to I editase domain.
Contains 2 DRADA repeats.
Contains 3 DRBM (double-stranded RNA-binding) domains. -
Post-translational
modificationsSumoylation reduces RNA-editing activity. -
Cellular localizationCytoplasm. Nucleus > nucleolus. Isoform 1 is found predominantly in cytoplasm but appears to shuttle between the cytoplasm and nucleus. Isoform 5 is found exclusively in the nucleolus.
- Information by UniProt
-
Database links
- Entrez Gene: 103 Human
- Entrez Gene: 56417 Mouse
- Entrez Gene: 81635 Rat
- Omim: 146920 Human
- SwissProt: P55265 Human
- SwissProt: Q99MU3 Mouse
- SwissProt: P55266 Rat
- Unigene: 12341 Human
see all -
Alternative names
- 136 kDa double-stranded RNA-binding protein antibody
- 136kDa double stranded RNA binding protein antibody
- Adar 1 antibody
see all
Datasheets and documents
Protocols
References
ab16138 has not yet been referenced specifically in any publications.
