Anti-ADAR1 antibody (ab16138)
Key features and details
- Sheep polyclonal to ADAR1
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-ADAR1 antibody
See all ADAR1 primary antibodies -
Description
Sheep polyclonal to ADAR1 -
Host species
Sheep -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Human -
Immunogen
Fusion protein: SFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEK NFYLCPVPND, corresponding to amino acids 1116-1176 of Rat ADAR1. The fusion protein was constructed in the pGEX-KG vector by inserting a fragment corresponding to nucleotides +3346 through +3525 of ADAR1 at the XbaI and XhoI sites in the vector.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.08% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Purified by Ammonium sulfate precipitation. This antibody is provided as a 0.2µm sterile filtered solution. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
Target
-
Function
Converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site-selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression. -
Tissue specificity
Ubiquitously expressed, highest levels were found in brain and lung. -
Involvement in disease
Defects in ADAR are a cause of dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]; also known as reticulate acropigmentation of Dohi. DSH is a pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet. -
Sequence similarities
Contains 1 A to I editase domain.
Contains 2 DRADA repeats.
Contains 3 DRBM (double-stranded RNA-binding) domains. -
Post-translational
modificationsSumoylation reduces RNA-editing activity. -
Cellular localization
Cytoplasm. Nucleus > nucleolus. Isoform 1 is found predominantly in cytoplasm but appears to shuttle between the cytoplasm and nucleus. Isoform 5 is found exclusively in the nucleolus. - Information by UniProt
-
Database links
- Entrez Gene: 103 Human
- Entrez Gene: 56417 Mouse
- Entrez Gene: 81635 Rat
- Omim: 146920 Human
- SwissProt: P55265 Human
- SwissProt: Q99MU3 Mouse
- SwissProt: P55266 Rat
- Unigene: 12341 Human
see all -
Alternative names
- 136 kDa double-stranded RNA-binding protein antibody
- 136kDa double stranded RNA binding protein antibody
- Adar 1 antibody
see all
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab16138 has not yet been referenced specifically in any publications.