For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    adar1-antibody-ab16138.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Interspecies Interaction Host Virus Interaction
Share by email

Anti-ADAR1 antibody (ab16138)

  • Datasheet
  • SDS
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Sheep polyclonal to ADAR1
  • Reacts with: Rat
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Rabbit Anti-Sheep IgG H&L (HRP) (ab6747)

View more associated products

Overview

  • Product name

    Anti-ADAR1 antibody
    See all ADAR1 primary antibodies
  • Description

    Sheep polyclonal to ADAR1
  • Host species

    Sheep
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Fusion protein: SFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEK NFYLCPVPND, corresponding to amino acids 1116-1176 of Rat ADAR1. The fusion protein was constructed in the pGEX-KG vector by inserting a fragment corresponding to nucleotides +3346 through +3525 of ADAR1 at the XbaI and XhoI sites in the vector.

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.08% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purified by Ammonium sulfate precipitation. This antibody is provided as a 0.2µm sterile filtered solution.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Microbiology
    • Interspecies Interaction
    • Host Virus Interaction
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • RNA Processing
    • RNAi
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • RNA Processing
    • Other
    • Epigenetics and Nuclear Signaling
    • Chromatin Modifying Enzymes
    • Deamination

Associated products

  • Isotype control

    • Sheep IgG - Isotype Control (ab37385)

Target

  • Function

    Converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site-selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression.
  • Tissue specificity

    Ubiquitously expressed, highest levels were found in brain and lung.
  • Involvement in disease

    Defects in ADAR are a cause of dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]; also known as reticulate acropigmentation of Dohi. DSH is a pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet.
  • Sequence similarities

    Contains 1 A to I editase domain.
    Contains 2 DRADA repeats.
    Contains 3 DRBM (double-stranded RNA-binding) domains.
  • Post-translational
    modifications

    Sumoylation reduces RNA-editing activity.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. Isoform 1 is found predominantly in cytoplasm but appears to shuttle between the cytoplasm and nucleus. Isoform 5 is found exclusively in the nucleolus.
  • Target information above from: UniProt accession P55265 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 103 Human
    • Entrez Gene: 56417 Mouse
    • Entrez Gene: 81635 Rat
    • Omim: 146920 Human
    • SwissProt: P55265 Human
    • SwissProt: Q99MU3 Mouse
    • SwissProt: P55266 Rat
    • Unigene: 12341 Human
    • Unigene: 679967 Human
    • Unigene: 316628 Mouse
    • Unigene: 10056 Rat
    see all
  • Alternative names

    • 136 kDa double-stranded RNA-binding protein antibody
    • 136kDa double stranded RNA binding protein antibody
    • Adar 1 antibody
    • ADAR antibody
    • Adar1 antibody
    • Adenosine deaminase acting on RNA 1 A antibody
    • Adenosine deaminase RNA specific 1 antibody
    • Adenosine deaminase RNA specific antibody
    • Adenosine deaminase that act on RNA antibody
    • AGS6 antibody
    • AV242451 antibody
    • Double stranded RNA specific adenosine deaminase antibody
    • Double-stranded RNA-specific adenosine deaminase antibody
    • Double-stranded RNA-specific editase Adar antibody
    • DRADA antibody
    • Dsh antibody
    • Dsrad antibody
    • DSRAD_HUMAN antibody
    • dsRNA adenosine deaminase antibody
    • EC 3.5.4.- antibody
    • G1P1 antibody
    • IFI 4 antibody
    • IFI-4 antibody
    • IFI4 antibody
    • Ifi4 protein antibody
    • Interferon induced protein 4 antibody
    • Interferon inducible protein 4 antibody
    • Interferon-inducible protein 4 antibody
    • K88DSRBP antibody
    • mZaADAR antibody
    • P136 antibody
    • Pre-mRNA adenosine deaminase antibody
    • RNA adenosine deaminase 1 antibody
    • RNA-editing deaminase 1 antibody
    • RNA-editing enzyme 1 antibody
    see all

Protocols

  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab16138? Please let us know so that we can cite the reference in this datasheet.

ab16138 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Western blot abreview for Anti-ADAR1 antibody

Inconclusive
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Mouse Cell lysate - whole cell (Natural Killer cells)
Gel Running Conditions
Reduced Denaturing (10% acrylamide)
Loading amount
25 µg
Specification
Natural Killer cells
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 0.05% · Temperature: 22°C
Read More

Abcam user community

Verified customer

Submitted Aug 21 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.