Overview

  • Product name

  • Description

    Rabbit polyclonal to ADAR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human ADAR1 aa 150-200 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV S


    Database link: P55265

  • Positive control

    • IHC-P: Human cervical cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab218128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site-selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression.
  • Tissue specificity

    Ubiquitously expressed, highest levels were found in brain and lung.
  • Involvement in disease

    Defects in ADAR are a cause of dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]; also known as reticulate acropigmentation of Dohi. DSH is a pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet.
  • Sequence similarities

    Contains 1 A to I editase domain.
    Contains 2 DRADA repeats.
    Contains 3 DRBM (double-stranded RNA-binding) domains.
  • Post-translational
    modifications

    Sumoylation reduces RNA-editing activity.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. Isoform 1 is found predominantly in cytoplasm but appears to shuttle between the cytoplasm and nucleus. Isoform 5 is found exclusively in the nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 136 kDa double-stranded RNA-binding protein antibody
    • 136kDa double stranded RNA binding protein antibody
    • Adar 1 antibody
    • ADAR antibody
    • Adar1 antibody
    • Adenosine deaminase acting on RNA 1 A antibody
    • Adenosine deaminase RNA specific 1 antibody
    • Adenosine deaminase RNA specific antibody
    • Adenosine deaminase that act on RNA antibody
    • AGS6 antibody
    • AV242451 antibody
    • Double stranded RNA specific adenosine deaminase antibody
    • Double-stranded RNA-specific adenosine deaminase antibody
    • Double-stranded RNA-specific editase Adar antibody
    • DRADA antibody
    • Dsh antibody
    • Dsrad antibody
    • DSRAD_HUMAN antibody
    • dsRNA adenosine deaminase antibody
    • EC 3.5.4.- antibody
    • G1P1 antibody
    • IFI 4 antibody
    • IFI-4 antibody
    • IFI4 antibody
    • Ifi4 protein antibody
    • Interferon induced protein 4 antibody
    • Interferon inducible protein 4 antibody
    • Interferon-inducible protein 4 antibody
    • K88DSRBP antibody
    • mZaADAR antibody
    • P136 antibody
    • Pre-mRNA adenosine deaminase antibody
    • RNA adenosine deaminase 1 antibody
    • RNA-editing deaminase 1 antibody
    • RNA-editing enzyme 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human cervical cancer tissue, labeling ADAR1 using ab218128, followed by conjugation to the secondary antibody and DAB staining.

References

ab218128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up