Overview

  • Product name

  • Description

    Rabbit polyclonal to ADAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human ADAT1 aa 1-501.
    Sequence:

    MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDT PDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQRYL LHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPM LEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLE PGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGS AKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCS DKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQ NVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISW SAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIA RDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQ F


    Database link: Q9BUB4

  • Positive control

    • WB: Mouse kidney and liver tissue lysates. THP-1, MD-MBA-231 and HL-60 whole cell lysates. IHC-P: Human skin and tonsil tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 55 kDa.

Target

Images

  • All lanes : Anti-ADAT1 antibody (ab235341) at 1/500 dilution

    Lane 1 : Mouse kidney tissue lysate
    Lane 2 : THP-1 (Human monocytic leukemia cell line) whole cell lysate
    Lane 3 : Mouse liver tissue lysate
    Lane 4 : MDA-MB-231 (Human breast adenocarcinoma cell line) whole cell lysate
    Lane 5 : HL-60 (Human promyelocytic leukemia cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 55 kDa

  • Paraffin-embedded human skin tissue stained for ADAT1 with ab235341 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for ADAT1 with ab235341 at 1/100 dilution in immunohistochemical analysis.

References

ab235341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up