Overview

  • Product name

    Anti-ADAT3 antibody - N-terminal
    See all ADAT3 primary antibodies
  • Description

    Rabbit polyclonal to ADAT3 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human ADAT3 aa 43-92 (N terminal). The exact sequence is proprietary.
    Sequence:

    VLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEM


    Database link: Q96EY9

  • Positive control

    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab192987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa.

Target

  • Sequence similarities

    Belongs to the cytidine and deoxycytidylate deaminase family. ADAT3 subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADAT3 antibody
    • ADAT3_HUMAN antibody
    • adenosine deaminase, tRNA specific 3, TAD3 homolog (S. cerevisiae) antibody
    • adenosine deaminase, tRNA-specific 3, TAD3 homolog antibody
    • FWP005 antibody
    • LOC113179 antibody
    • MST121 antibody
    • MSTP121 antibody
    • Probable inactive tRNA-specific adenosine deaminase-like protein 3 antibody
    • S863 5 antibody
    • TAD3 antibody
    • TAD3, S. cerevisiae, homolog of antibody
    • tRNA specific adenosine 34 deaminase subunit ADAT3 antibody
    • tRNA specific adenosine deaminase like protein 3 antibody
    • tRNA-specific adenosine deaminase 3 homolog antibody
    • tRNA-specific adenosine-34 deaminase subunit ADAT3 antibody
    see all

Images

  • Anti-ADAT3 antibody - N-terminal (ab192987) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 38 kDa

References

ab192987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up