Overview

  • Product name

  • Description

    Rabbit polyclonal to ADCK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse ADCK2 aa 200-609.
    Sequence:

    FETREPVGSGCVAQVYKAFASISLLEEDRIWRLGELSAPGTRAVVMQREP FMKDRKPSENLADEAFLEKLLLPKADLGGSEVGVSQAPWHLPKSDHLIPV AVKVLHPGLLSQVSMDLLLMKIGSKALGLLPGVKWLSLPEIVEEFEKLMV QQTDLRYEAQNLEHFQHNFQDMASVKFPTPLRPLITRDILVETYEESVPV SSYQQAGIPTDLKRKIAQLGINMLLKMIFVDNFVHGDLHPGNILVQGADG VSPSLEMQQQQVNVCDTLVATIAPALCPLRLVLLDAGIVAKLQASDLRNF RAVFQAVVMGQGHRVAELMLHHAQANECRDVERFKAEMATLVTQARKNIV TLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVVAIMVLEGLGRSLDPTL DILEAAKPFL


    Database link: Q6NSR3

  • Positive control

    • WB: K562 whole cell lysate. IHC-P: Human testis and prostate cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 69 kDa.

Target

  • Function

    The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
  • Sequence similarities

    Belongs to the protein kinase superfamily. ADCK protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AARF antibody
    • aarF domain containing kinase 2 antibody
    • ADCK2 antibody
    • ADCK2_HUMAN antibody
    • MGC20727 antibody
    • Putative ubiquinone biosynthesis protein AarF antibody
    • Uncharacterized aarF domain-containing protein kinase 2 antibody
    see all

Images

  • Anti-ADCK2 antibody (ab235312) at 1/1000 dilution + K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    Goat polyclonal to Rabbit IgG at 1/50000 dilution

    Predicted band size: 69 kDa

  • Paraffin-embedded human testis tissue stained for ADCK2 using ab235312 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for ADCK2 using ab235312 at 1/100 dilution in immunohistochemical analysis.

References

ab235312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up