Overview

  • Product name

  • Description

    Rabbit polyclonal to ADCY10/SAC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human ADCY10/SAC aa 1135-1185 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SLKGEVCFNMGQIVLAKKMLRKALKLLNRIFPYNLISLFLHIHVEKNRHF H


    Database link: Q96PN6

  • Positive control

    • Human liver cancer, rat brain and rat lung tissue.
  • General notes

     This product was previously labelled as ADCY10

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

WB 1/100 - 1/1000. Predicted molecular weight: 187 kDa.

Target

  • Relevance

    ADCY10 belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.
  • Cellular localization

    Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Note: Distributed to subcellular compartments containing cAMP targets. Found as a plasma membrane associated protein, protein concentrated in the perinuclear region and protein colocalized with actin or tubulin.
  • Database links

  • Alternative names

    • 3',5'-cyclic AMP synthetase antibody
    • Adenylate cyclase 10 (soluble) antibody
    • Adenylate cyclase 10 antibody
    • Adenylate cyclase homolog antibody
    • AH related protein antibody
    • ATP pyrophosphate-lyase antibody
    • Germ cell soluble adenylyl cyclase antibody
    • HCA2 antibody
    • hsAC antibody
    • hypercalciuria absorptive antibody
    • SAC antibody
    • SACI antibody
    • Sacy antibody
    • Soluble adenylyl cyclase antibody
    • testicular soluble adenylyl cyclase (SAC) antibody
    • Testicular soluble adenylyl cyclase antibody
    see all

Images

  • Immunohistochemistry on Formalin/PFA-fixed paraffin-embedded rat brain tissue  labeling ADCY10/SAC with ab203204 at a 1/200 dilution, followed by conjugation to the secondary antibody Goat anti-rabbit IgG-Cy3 at a 1/200 dilution.

  • Immunohistochemistry on Formalin/PFA-fixed paraffin-embedded rat lung tissue labeling ADCY10/SAC with ab203204 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemistry on Formalin/PFA-fixed paraffin-embedded human liver cancer tissue  labeling ADCY10/SAC with ab203204 at a 1/100 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Shaw PX  et al. Soluble Adenylyl Cyclase Is Required for Retinal Ganglion Cell and Photoreceptor Differentiation. Invest Ophthalmol Vis Sci 57:5083-5092 (2016). IHC-Fr ; Mouse . Read more (PubMed: 27679853) »
  • Nixon B  et al. The Australian saltwater crocodile (Crocodylus porosus) provides evidence that the capacitation of spermatozoa may extend beyond the mammalian lineage. Proc Biol Sci 283:N/A (2016). Read more (PubMed: 27147099) »
See all 2 Publications for this product

Customer reviews and Q&As

Application
Immunocytochemistry
Sample
Mouse Cultured Cells (Osteocyte-like cell line (MLO-Y4s))
Permeabilization
Yes - 0.1% Triton X-100
Specification
Osteocyte-like cell line (MLO-Y4s)
Blocking step
2% goat serum, 3% BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Fixative
Formaldehyde

Emily Moore

Verified customer

Submitted Mar 10 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up