Overview

  • Product name

  • Description

    Rabbit polyclonal to ADCY10/SAC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Fr, WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human ADCY10/SAC aa 396-445.
    Sequence:

    VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL


    Database link: NP_060887
    (Peptide available as ab211578)

  • Positive control

    • Human fetal brain lysate
  • General notes

     This product was previously labelled as ADCY10

     

Properties

Applications

Our Abpromise guarantee covers the use of ab82854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration. PubMed: 22649251
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 187 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Target

  • Relevance

    ADCY10 belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.
  • Cellular localization

    Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Note: Distributed to subcellular compartments containing cAMP targets. Found as a plasma membrane associated protein, protein concentrated in the perinuclear region and protein colocalized with actin or tubulin.
  • Database links

  • Alternative names

    • 3',5'-cyclic AMP synthetase antibody
    • Adenylate cyclase 10 (soluble) antibody
    • Adenylate cyclase 10 antibody
    • Adenylate cyclase homolog antibody
    • AH related protein antibody
    • ATP pyrophosphate-lyase antibody
    • Germ cell soluble adenylyl cyclase antibody
    • HCA2 antibody
    • hsAC antibody
    • hypercalciuria absorptive antibody
    • SAC antibody
    • SACI antibody
    • Sacy antibody
    • Soluble adenylyl cyclase antibody
    • testicular soluble adenylyl cyclase (SAC) antibody
    • Testicular soluble adenylyl cyclase antibody
    see all

Images

  • Anti-ADCY10/SAC antibody (ab82854) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal Brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 187 kDa
    Observed band size: 145 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 40 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration 6-18%

References

This product has been referenced in:

  • Shaw PX  et al. Soluble Adenylyl Cyclase Is Required for Retinal Ganglion Cell and Photoreceptor Differentiation. Invest Ophthalmol Vis Sci 57:5083-5092 (2016). WB ; Mouse . Read more (PubMed: 27679853) »
  • Corredor RG  et al. Soluble adenylyl cyclase activity is necessary for retinal ganglion cell survival and axon growth. J Neurosci 32:7734-44 (2012). IHC-Fr ; Rat . Read more (PubMed: 22649251) »
See all 2 Publications for this product

Customer reviews and Q&As

Answer

Thank you for your inquiry.

Please find the answers to the questions below:

1.) I suggest to use 10-30ug of total protein per well on the gel. This might have to be optimised, but I recommend to start with 20ug and optimise form there.

The samples are heated at 95C form 10 minutes.

2.) 10 x PBS

Dissolve the following in 800ml distilled H2O.
80g of NaCl

2.0g of KCl

14.4g of Na2HPO4

2.4g of KH2PO4





Adjust pH to 7.4.

Adjust volume to 1L with additional distilled H2O.

Sterilize by autoclaving.




For a 1X solution, mix 1 part of the 10X solution with 9 parts distilled waterand pH to 7.4 again.



3.) PBS - Tween was used for washing:

1 x PBS with 0.1% Tween (For 1 liter: 100 ml of PBS 10X + 900 ml distilled water + 1ml Tween-20)
Usually there are 3 washes after each incubation time that are 5 minutes long each.



4.) I can recommend to use the same blocking agent in all solutions and not to mix different blocking agents. For the antibody solutions 5% blocking agnet can be used, but I recommend to start with 1% blocking agent and to increase this only when high background occurs.



More information about standard protocols can be found on our homepage:



https://www.abcam.com/index.html?pageconfig=popular_protocols



I hope this information is helpful and wish you good luck with your experiments. Please feel free to contact me again with any further questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up