Overview

  • Product name

  • Description

    Rabbit polyclonal to ADCY4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ADCY4 aa 808-1077.
    Sequence:

    RQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQ NRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIA DFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLG TMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIW GNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQL CTYFLNTDLTRTGPPSATLG


    Database link: Q8NFM4

  • Positive control

    • IHC-P: Human thyroid tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230228 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human thyroid tissue stained for ADCY4 using ab230228 at 1/100 dilution in immunohistochemical analysis.

References

ab230228 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230228.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up