Overview

  • Product name

    Anti-Adenine Nucleotide Translocase 1/ANT 1 antibody
    See all Adenine Nucleotide Translocase 1/ANT 1 primary antibodies
  • Description

    Rabbit polyclonal to Adenine Nucleotide Translocase 1/ANT 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Adenine Nucleotide Translocase 1/ANT 1 aa 35-84 (N terminal).
    Sequence:

    LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT

  • Positive control

    • RPMI-8826 lysate
  • General notes

    Previously labelled as Adenine Nucleotide Translocase 1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab102032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P 1/100.
ICC/IF 1/100.

Target

  • Function

    Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane.
  • Involvement in disease

    Defects in SLC25A4 are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 2 (PEOA2) [MIM:609283]. Progressive external ophthalmoplegia is characterized by progressive weakness of ocular muscles and levator muscle of the upper eyelid. In a minority of cases, it is associated with skeletal myopathy, which predominantly involves axial or proximal muscles and which causes abnormal fatigability and even permanent muscle weakness. Ragged-red fibers and atrophy are found on muscle biopsy. A large proportion of chronic ophthalmoplegias are associated with other symptoms, leading to a multisystemic pattern of this disease. Additional symptoms are variable, and may include cataracts, hearing loss, sensory axonal neuropathy, ataxia, depression, hypogonadism, and parkinsonism.
  • Sequence similarities

    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AAC1 antibody
    • Adenine Nucleotide Translocase 1 antibody
    • Adenine nucleotide translocator 1 (skeletal muscle) antibody
    • Adenine nucleotide translocator 1 antibody
    • ADP antibody
    • ADP ATP carrier protein 1 antibody
    • ADP ATP carrier protein heart/skeletal muscle isoform T1 antibody
    • ADP/ATP translocase 1 antibody
    • ADT1_HUMAN antibody
    • ANT 1 antibody
    • ANT antibody
    • ANT1 antibody
    • ATP carrier protein 1 antibody
    • ATP carrier protein antibody
    • heart/skeletal muscle isoform T1 antibody
    • PEO2 antibody
    • PEO3 antibody
    • SLC25A4 antibody
    • Solute carrier family 25 member 4 antibody
    • T1 antibody
    see all

Images

  • Anti-Adenine Nucleotide Translocase 1/ANT 1 antibody (ab102032) at 1 µg/ml + RPMI-8226 Cell Lysate at 10 µg

    Predicted band size: 33 kDa



    12% SDS PAGE
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling Adenine Nucleotide Translocase 1/ANT 1 with ab102032 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm of cell bodies of pinealocytes and their processes. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Bottom left - DAPI. Top right - Adenine Nucleotide Translocase 1. Top left - Merge.

  • ab102032 staining Adenine Nucleotide Translocase 1/ANT 1 from  HEK293 cell line from Human by ICC/IF (Immunocytochemistry/immunofluorescence).Cells were  fixed with paraformaldehyde,permeabilized with 1% Triton X-100.Samples were incubated with primary antibody for 16 hours at 4 °C.A diluted Alexa Fluor® 488-conjugated goat anti-rabbit IgG polyclonal was used as the secondary antibody.

References

This product has been referenced in:

  • Sailani MR  et al. Lifelong physical activity is associated with promoter hypomethylation of genes involved in metabolism, myogenesis, contractile properties and oxidative stress resistance in aged human skeletal muscle. Sci Rep 9:3272 (2019). Read more (PubMed: 30824849) »
  • Wen J  et al. Protective effects of higenamine combined with [6]-gingerol against doxorubicin-induced mitochondrial dysfunction and toxicity in H9c2 cells and potential mechanisms. Biomed Pharmacother 115:108881 (2019). Read more (PubMed: 31028997) »
See all 3 Publications for this product

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (MEF)
Permeabilization
Yes - 1% TRITON-X-100
Specification
MEF
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 09 2014

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HEK293)
Permeabilization
Yes - 1% TRITON-X-100
Specification
HEK293
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 08 2014

Application
Western blot
Sample
Rat Cell lysate - whole cell (h9c2)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
h9c2
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Sep 08 2014

Application
Western blot
Sample
Mouse Cell lysate - whole cell (MEF)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
MEF
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Aug 27 2014

Application
Western blot
Sample
Human Cell lysate - whole cell (HEK293)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
HEK293
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Aug 27 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up