Overview

  • Product name

    Anti-Adenine Nucleotide Translocator 2/ANT 2 antibody
    See all Adenine Nucleotide Translocator 2/ANT 2 primary antibodies
  • Description

    Rabbit polyclonal to Adenine Nucleotide Translocator 2/ANT 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Adenine Nucleotide Translocator 2/ANT 2 aa 144-175.
    Sequence:

    DVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQ


    Database link: P05141

  • Positive control

    • IHC-P: Human lung cancer tissue and small intestine tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab222843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human small intestine tissue stained for Adenine Nucleotide Translocator 2/ANT 2 using ab222843 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for Adenine Nucleotide Translocator 2/ANT 2 using ab222843 at 1/100 dilution in immunohistochemical analysis.

References

ab222843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (lung bronchial epithelial cell, Beas-2B)
Gel Running Conditions
Reduced Denaturing (10%)
Loading amount
10 µg
Specification
lung bronchial epithelial cell, Beas-2B
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5%

Abcam user community

Verified customer

Submitted May 03 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up