Overview

  • Product name

    Anti-Adenosine A2b Receptor/ADORA2B antibody
    See all Adenosine A2b Receptor/ADORA2B primary antibodies
  • Description

    Rabbit polyclonal to Adenosine A2b Receptor/ADORA2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Adenosine A2b Receptor/ADORA2B aa 292-332 (C terminal).
    Sequence:

    YRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL


    Database link: P29275

  • Positive control

    • WB: Mouse brain tissue lysate. ICC/IF: HepG2 cells. IHC-P: Human brain and kidney tissue.
  • General notes

     This product was previously labelled as Adenosine A2b Receptor

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Adenosine A2b Receptor/ADORA2B (green) using ab222901 (1/100 dilution) in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L) .

  • Anti-Adenosine A2b Receptor/ADORA2B antibody (ab222901) at 1/500 dilution + mouse brain tissue

    Secondary
    Goat polyclonal to rabbit IgG at 1/500000 dilution
  • Paraffin embedded human brain tissue stained for Adenosine A2b Receptor/ADORA2B with ab222901 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human kidney tissue stained for Adenosine A2b Receptor/ADORA2B with ab222901 (1/100 dilution) in immunohistochemical analysis.

References

ab222901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up