Anti-Adenovirus Type 5 E1A antibody (ab204123)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Adenovirus Type 5 E1A antibody -
Description
Rabbit polyclonal to Adenovirus Type 5 E1A -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Other species -
Immunogen
Synthetic peptide within Adenovirus Type 5 E1A aa 180-230 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Human Adenovirus Type 5 E1A
Sequence:GMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSST D
Database link: P03255 -
Positive control
- Rat brain lysate
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204123 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. When using a fluorescent probe the recommended dilution range is 1/50 - 1/200 |
|
| WB | 1/100 - 1/1000. |
Target
-
Relevance
The early region (E1A) of the adenovirus genome plays a central role in cellular transformation and regulation of gene expression. The E1A region encodes a series of related proteins (35-46kDa) with multifuctional capabilities and form a specific complex with the retinoblastoma tumor suppressor gene product (Rb protein). The E1A and E1B regions together comprise the transforming region of adenovirus. While expression of E1A alone is sufficient to immortalize primary cells, complete transformation requires the additional expression of the E1B region. Several conserved regions of E1A are similar to portions of other viral oncoproteins like the HPV-16 and HPV-18 E7 and SV40 large T antigen. -
Database links
- SwissProt: P03255 Other species
-
Alternative names
- Hadv 5 E1A antibody
- HAdv5 E1A antibody
Images
-
Western blot - Anti-Adenovirus Type 5 E1A antibody (ab204123)All lanes : Anti-Adenovirus Type 5 E1A antibody (ab204123) at 1/200 dilution
Lane 1 : Rat brain lysate
Lane 2 : Rat liver lysate
Secondary
All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/3000 dilution
Observed band size: 39 kDa why is the actual band size different from the predicted?12% gel
Datasheets and documents
References
ab204123 has not yet been referenced specifically in any publications.
