Overview

  • Product name

    Anti-Adenovirus Type 5 E1A antibody
  • Description

    Rabbit polyclonal to Adenovirus Type 5 E1A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Other species
  • Immunogen

    Synthetic peptide within Adenovirus Type 5 E1A aa 180-230 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Human Adenovirus Type 5 E1A
    Sequence:

    GMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSST D


    Database link: P03255

  • Positive control

    • Rat brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab204123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution range is 1/50 - 1/200

WB 1/100 - 1/1000.

Target

  • Relevance

    The early region (E1A) of the adenovirus genome plays a central role in cellular transformation and regulation of gene expression. The E1A region encodes a series of related proteins (35-46kDa) with multifuctional capabilities and form a specific complex with the retinoblastoma tumor suppressor gene product (Rb protein). The E1A and E1B regions together comprise the transforming region of adenovirus. While expression of E1A alone is sufficient to immortalize primary cells, complete transformation requires the additional expression of the E1B region. Several conserved regions of E1A are similar to portions of other viral oncoproteins like the HPV-16 and HPV-18 E7 and SV40 large T antigen.
  • Database links

    • Alternative names

      • Hadv 5 E1A antibody
      • HAdv5 E1A antibody

    Images

    • All lanes : Anti-Adenovirus Type 5 E1A antibody (ab204123) at 1/200 dilution

      Lane 1 : Rat brain lysate
      Lane 2 : Rat liver lysate

      Secondary
      All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/3000 dilution

      Observed band size: 39 kDa
      why is the actual band size different from the predicted?



      12% gel

    References

    ab204123 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab204123.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up