Overview

  • Product name

    Anti-ADFP antibody [2C5A3]
    See all ADFP primary antibodies
  • Description

    Mouse monoclonal [2C5A3] to ADFP
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ADFP aa 286-437. (Expressed in E.coli).
    Sequence:

    VEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGV PQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESL DDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHK TH


    Database link: Q99541

  • Positive control

    • ADFP recombinant protein; ADFP (Amino acids: 286-437)-hIgGFc transfected HEK293 cell lysate; Human liver cancer and esophageal cancer tissues.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR154667-17 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab181463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 48 kDa.

Target

  • Function

    May be involved in development and maintenance of adipose tissue.
  • Tissue specificity

    Milk lipid globules.
  • Sequence similarities

    Belongs to the perilipin family.
  • Post-translational
    modifications

    Acylated; primarily with C14, C16 and C18 fatty acids.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADFP antibody
    • Adipophilin antibody
    • Adipose differentiation related protein antibody
    • Adipose differentiation-related protein antibody
    • ADRP antibody
    • MGC10598 antibody
    • Perilipin-2 antibody
    • PLIN2 antibody
    • PLIN2_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human esophageal cancer tissue labeling ADFP with ab181463 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling ADFP with ab181463 at 1/200 dilution.

  • All lanes : Anti-ADFP antibody [2C5A3] (ab181463) at 1/500 dilution

    Lane 1 : HEK293 cell lysate.
    Lane 2 : ADFP (Amino acids : 286-437)-hIgGFc transfected HEK293 cell lysate.

    Predicted band size: 48 kDa

  • Anti-ADFP antibody [2C5A3] (ab181463) at 1/500 dilution + ADFP recombinant protein.

    Predicted band size: 48 kDa



    Expected MWt is 42.6 kDa.

References

ab181463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up