Anti-ADFP antibody [2C5H8] (ab181452)

Overview

  • Product name
    Anti-ADFP antibody [2C5H8]
    See all ADFP primary antibodies
  • Description
    Mouse monoclonal [2C5H8] to ADFP
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human ADFP aa 268-437. Expressed in E. coli.
    Sequence:

    VEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGV PQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESL DDVMDYLVNNTPLNWLVGPFYPQLT ESQNAQDQGA EMDKSSQETQ RSEHKTH


    Database link: Q99541

  • Positive control
    • ADFP recombinant protein; ADFP transfected HEK293 cell lysate; HepG2 cells and cell lysate; Human rectum cancer tissue; Human bladder cancer tissue.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR197175-12 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab181452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function
    May be involved in development and maintenance of adipose tissue.
  • Tissue specificity
    Milk lipid globules.
  • Sequence similarities
    Belongs to the perilipin family.
  • Post-translational
    modifications
    Acylated; primarily with C14, C16 and C18 fatty acids.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ADFP antibody
    • Adipophilin antibody
    • Adipose differentiation related protein antibody
    • Adipose differentiation-related protein antibody
    • ADRP antibody
    • MGC10598 antibody
    • Perilipin-2 antibody
    • PLIN2 antibody
    • PLIN2_HUMAN antibody
    see all

Images

  • Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution + HepG2 cell lysate
  • All lanes : Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : ADFP-transfected HEK293 cell lysate
  • Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution + ADFP recombinant protein
  • Immunohistochemical analysis of paraffin-embedded Human bladder cancer tissue labeling ADFP with ab181452 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling ADFP with ab181452 at 1/200 dilution.

  • Immunofluorescent analysis of HepG2 cells labeling ADFP with ab181452 (green) at 1/200 dilution. Blue: DRAQ5 fluorescent DNA dye.

  • Flow cytometric analysis of HepG2 cells labeling ADFP with ab181452 (green) at 1/200 dilution, and negative control (red).

References

ab181452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Pig Tissue sections (Liver pig)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citratbuffer
Permeabilization
No
Specification
Liver pig
Blocking step
HRP Polymer Kit as blocking agent for 5 minute(s) · Concentration: 3% · Temperature: RT°C
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted May 18 2018

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up