Overview

  • Product name

    Anti-ADGB/Androglobin antibody
  • Description

    Rabbit polyclonal to ADGB/Androglobin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ADGB/Androglobin aa 597-693.
    Sequence:

    DGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIY IFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVR


    Database link: Q8N7X0

  • Positive control

    • A431 cells; Human fallopian tube tissue.
  • General notes

     This product was previously labelled as ADGB

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100,

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Belongs to the peptidase C2 family. Contains 1 calpain catalytic domain. Contains 1 IQ domain. There are two known isoforms.
  • Cellular localization

    Intracellular
  • Database links

  • Alternative names

    • androglobin antibody
    • C6orf103 antibody
    • Calpain-7-Like Protein antibody
    • CAPN7L antibody
    • Chromosome 6 Open Reading Frame 103 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human fallopian tube tissue labeling ADGB/Androglobin with ab204085 at 1/200 dilution.

  • Immunofluorescent analysis of paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized A431 cells labeling ADGB/Androglobin with ab204085 at 4 µg/ml (green).

References

ab204085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up