Overview

  • Product name

  • Description

    Rabbit polyclonal to ADH4
  • Host species

    Rabbit
  • Specificity

    ab192414 detects endogenous levels of ADH4 protein.
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ADH4 aa 1-380.
    Sequence:

    MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTD ATVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCR KCKFCLSPLTNLCGKISNLK SPASDQQLMEDKTSRFTCKGKPVYHFFG TSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPG STCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLN PRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFI GVAAGSKGLTIFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNL DALVTHTLPFDKISEAFDLMNQGKSVRTILIF


    Database link: P08319

Properties

Applications

Our Abpromise guarantee covers the use of ab192414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 40 kDa.
IHC-P Use at an assay dependent concentration.

Target

References

ab192414 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up