Overview

  • Product name
  • Description
    Rabbit polyclonal to ADH5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Horse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human ADH5 aa 1-374.
    Sequence:

    MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAY TLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGEC KFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYT VVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGL GGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPI QEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEE IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNL SFDEINKAFELMHSGKSIRTVVKI


    Database link: P11766

  • Positive control
    • Kidney cell line extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab175406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.

Target

  • Function
    Class-III ADH is remarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione.
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family. Class-III subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ADH 3 antibody
    • ADH5 antibody
    • ADHX antibody
    • ADHX_HUMAN antibody
    • Alcohol dehydrogenase (class III) chi polypeptide antibody
    • alcohol dehydrogenase 5 (class III) chi polypeptide antibody
    • Alcohol dehydrogenase 5 antibody
    • Alcohol dehydrogenase class 3 antibody
    • Alcohol dehydrogenase class chi chain antibody
    • Alcohol dehydrogenase class III antibody
    • Alcohol dehydrogenase class-3 antibody
    • Alcohol dehydrogenase class-III antibody
    • class III alcohol dehydrogenase 5 chi subunit antibody
    • FALDH antibody
    • FDH antibody
    • formaldehyde dehydrogenase antibody
    • Glutathione dependent formaldehyde dehydrogenase antibody
    • Glutathione-dependent formaldehyde dehydrogenase antibody
    • GSH-FDH antibody
    • GSNOR antibody
    • hydroxymethyllutathione dehydrogenase antibody
    • S-(hydroxymethyl)glutathione dehydrogenase antibody
    see all

Images

  • Anti-ADH5 antibody (ab175406) at 1/500 dilution + Mouse Kidney Cell line extract

    Predicted band size: 40 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling ADH5 with ab175406 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human rectal cancer tissue labelling ADH5 with ab175406 at 1/200. Magnification: 400x.
  • Immunocytochemistry/Immunofluorescence analysis of HepG2 cells using ab175406. Blue DAPI for nuclear staining.

References

ab175406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up