Overview

  • Product name

  • Description

    Rabbit polyclonal to ADH7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ADH7 aa 1-386.
    Sequence:

    MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVR IKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGD KVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVH HFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGK VKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGAT ECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK KFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF


    Database link: P40394

  • Positive control

    • WB: Mouse liver tissue lysate. IHC-P: Human lung, lung cancer and gastric cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 41 kDa.

Target

  • Relevance

    This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members.
  • Cellular localization

    Cytoplasm
  • Database links

  • Alternative names

    • ADH 4 antibody
    • ADH 7 antibody
    • ADH, class IV antibody
    • ADH4 antibody
    • Alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide antibody
    • alcohol dehydrogenase 7 antibody
    • alcohol dehydrogenase class 4 mu/sigma chain antibody
    • Alcohol dehydrogenase class IV mu/sigma chain antibody
    • alcohol dehydrogenase VII antibody
    • class IV sigma 1 alcohol dehydrogenase antibody
    • class IV sigmasigma alcohol dehydrogenase antibody
    • Gastric alcohol dehydrogenase antibody
    • Gastric H(+)/K(+) ATPase subunit alpha antibody
    • Retinol dehydrogenase antibody
    see all

Images

  • Anti-ADH7 antibody (ab236767) at 1/1000 dilution + Mouse liver tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 41 kDa

  • Paraffin-embedded human lung tissue stained for ADH7 with ab236767 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for ADH7 with ab236767 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for ADH7 with ab236767 at 1/100 dilution in immunohistochemical analysis.

References

ab236767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up