Overview

  • Product name

    Anti-Adiponectin Receptor 2/ADIPOR2 antibody
    See all Adiponectin Receptor 2/ADIPOR2 primary antibodies
  • Description

    Rabbit polyclonal to Adiponectin Receptor 2/ADIPOR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Adiponectin Receptor 2/ADIPOR2 aa 1-147. Expressed in E.coli.
    Sequence:

    MNEPTEHRLGCTRTPEPDIRLRKGHQLDDTRGGNNDNHHGDLEPSLETPV CSSYYENSPEELECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWE GRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG


    Database link: Q3YAF7

  • Positive control

    • IHC-P: Rat liver, testis, skeletal muscle, heart, kidney and stomach tissues. WB: Rat serum; Rat uterus lysate; Recombinant rat Adiponectin Receptor 2/ADIPOR2 protein.
  • General notes

     This product was previously labelled as Adiponectin Receptor 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 44 kDa.

Target

  • Function

    Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some intermediate-affinity receptor activity for both globular and full-length adiponectin.
  • Tissue specificity

    Highly expressed in skeletal muscle, liver and placenta. Weakly expressed in brain, heart, colon, spleen, kidney, thymus, small intestine, peripheral blood leukocytes and lung.
  • Sequence similarities

    Belongs to the ADIPOR family.
  • Domain

    The N-terminus is known to be cytoplasmic while the C-terminus is known to be extracellular.
  • Cellular localization

    Membrane. Localized to the cell membrane and intracellular organelles.
  • Information by UniProt
  • Database links

  • Alternative names

    • PAQR2 antibody
    • ACDCR2 antibody
    • Adiponectin receptor protein 2 antibody
    • Adipor2 antibody
    • ADR2_HUMAN antibody
    • Progestin and adipoQ receptor family member II antibody
    see all

Images

  • All lanes : Anti-Adiponectin Receptor 2/ADIPOR2 antibody (ab231051) at 1 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Rat uterus lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution

    Predicted band size: 44 kDa

  • Paraffin-embedded rat liver tissue stained for Adiponectin Receptor 2/ADIPOR2 using ab231051 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

           

  • Paraffin-embedded rat testis tissue stained for Adiponectin Receptor 2/ADIPOR2 using ab231051 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

  • Paraffin-embedded rat skeletal muscle tissue stained for Adiponectin Receptor 2/ADIPOR2 using ab231051 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

  • Paraffin-embedded rat heart tissue stained for Adiponectin Receptor 2/ADIPOR2 using ab231051 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

  • Paraffin-embedded rat kidney tissue stained for Adiponectin Receptor 2/ADIPOR2 using ab231051 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

  • Paraffin-embedded rat stomach tissue stained for Adiponectin Receptor 2/ADIPOR2 using ab231051 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

  • Anti-Adiponectin Receptor 2/ADIPOR2 antibody (ab231051) at 2 µg/ml + Recombinant rat Adiponectin Receptor 2/ADIPOR2 protein

    Predicted band size: 44 kDa

References

ab231051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up