Overview

  • Product name

    Anti-Adipose Triglyceride Lipase antibody
    See all Adipose Triglyceride Lipase primary antibodies
  • Description

    Rabbit polyclonal to Adipose Triglyceride Lipase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Adipose Triglyceride Lipase aa 372-463. Numbering is from isoform 1; the sequence also occus in isoform 2.
    Sequence:

    SICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPG WMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRA


    Database link: Q96AD5

  • Positive control

    • A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Catalyzes the initial step in triglyceride hydrolysis in adipocyte and non-adipocyte lipid droplets. Also has acylglycerol transacylase activity. May act coordinately with LIPE/HLS within the lipolytic cascade. Regulates adiposome size and may be involved in the degradation of adiposomes. May play an important role in energy homeostasis. May play a role in the response of the organism to starvation, enhancing hydrolysis of triglycerides and providing free fatty acids to other tissues to be oxidized in situations of energy depletion.
  • Tissue specificity

    Highest expression in adipose tissue. Also detected in heart, skeletal muscle, and portions of the gastrointestinal tract. Detected in normal retina and retinoblastoma cells. Detected in retinal pigment epithelium and, at lower intensity, in the inner segments of photoreceptors and in the ganglion cell layer of the neural retina (at protein level).
  • Pathway

    Glycerolipid metabolism; triacylglycerol degradation.
  • Involvement in disease

    Note=Genetic variations in PNPLA2 may be associated with risk of diabetes mellitus type 2.
    Defects in PNPLA2 are the cause of neutral lipid storage disease with myopathy (NLSDM) [MIM:610717]; also known as neutral lipid storage disease without ichthyosis. NSLDM is a neutral lipid storage disorder (NLSD) with myopathy but without ichthyosis. NLSDs are characterized by the presence of triglyceride-containing cytoplasmic droplets in leukocytes and in other tissues, including bone marrow, skin, and muscle. Individuals with NLSDM did not show obesity, in spite of a defect in triglyceride degradation in fibroblasts and in marked triglyceride storage in liver, muscles, and other visceral cells.
  • Sequence similarities

    Contains 1 patatin domain.
  • Developmental stage

    Induced during differentiation of primary preadipocytes to adipocytes. Expression increased from fetal to adult in retinal pigment epithelium.
  • Cellular localization

    Lipid droplet. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110001C14Rik antibody
    • Adipose triglyceride lipase antibody
    • ATGL antibody
    • ATGL DESNUTRIN antibody
    • Calcium independent phospholipase A2 antibody
    • Calcium-independent phospholipase A2 antibody
    • Desnutrin antibody
    • EC 3.1.1.3 antibody
    • FP17548 antibody
    • IPLA2 zeta antibody
    • IPLA2-zeta antibody
    • Mutant patatin like phospholipase domain containing 2 antibody
    • Patatin like phospholipase domain containing 2 antibody
    • PATATIN LIKE PHOSPHOLIPASE DOMAIN CONTAINING PROTEIN 2 antibody
    • Patatin-like phospholipase domain-containing protein 2 antibody
    • PEDF R antibody
    • PHOSPHOLIPASE A2 CALCIUM INDEPENDENT ZETA antibody
    • Pigment epithelium derived factor antibody
    • Pigment epithelium-derived factor antibody
    • plpl antibody
    • plpl2 antibody
    • PLPL2_HUMAN antibody
    • Pnpla2 antibody
    • Transport secretion protein 2 antibody
    • Transport secretion protein 2.2 antibody
    • Transport-secretion protein 2 antibody
    • Triglyceride hydrolase antibody
    • TTS 2.2 antibody
    • TTS2 antibody
    • TTS2.2 antibody
    • ZETA antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A549 cells labeling Adipose Triglyceride Lipase  with ab220738 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab220738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up