Overview

  • Product name

  • Description

    Rabbit polyclonal to ADK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Human ADK aa 106-187.
    Sequence:

    CIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANL AAANCYKKEKHLDLEKNWMLVEKARVCYIAGF


    Database link: P55263

  • Positive control

    • Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human kidney tissue labeling ADK with ab204430 at 1/20.

References

This product has been referenced in:

  • Poppe D  et al. Genome Editing in Neuroepithelial Stem Cells to Generate Human Neurons with High Adenosine-Releasing Capacity. Stem Cells Transl Med 7:477-486 (2018). Read more (PubMed: 29589874) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up