Overview

  • Product name

    Anti-ADPGK antibody - C-terminal
    See all ADPGK primary antibodies
  • Description

    Rabbit polyclonal to ADPGK - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ADPGK aa 218-497 (C terminal).
    Sequence:

    WGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMME GQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFP AVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHG RSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACAT ETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPV LVCKDPIRTVGLGDAISAEGLFYSEVHPHY


    Database link: Q9BRR6

  • Positive control

    • IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency.
  • Pathway

    Carbohydrate degradation; glycolysis.
  • Sequence similarities

    Belongs to the ADP-dependent glucokinase family.
    Contains 1 ADPK (ADP-dependent kinase) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2610017G09Rik antibody
    • ADP dependent glucokinase antibody
    • ADP GK antibody
    • ADP-dependent glucokinase antibody
    • ADP-GK antibody
    • ADPGK antibody
    • ADPGK_HUMAN antibody
    • ATP dependent glucokinase antibody
    • DKFZP434B195 antibody
    • RbBP 35 antibody
    • RbBP-35 antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for ADPGK using ab230007 at 1/100 dilution in immunohistochemical analysis.

References

ab230007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up