Overview

  • Product name

    Anti-Adracalin antibody - C-terminal
    See all Adracalin primary antibodies
  • Description

    Rabbit polyclonal to Adracalin - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla
  • Immunogen

    Synthetic peptide within Human Adracalin aa 496-546 (C terminal). The exact sequence is proprietary. (NP_056480.1).
    Sequence:

    PVLGRAQEPPAGGGGSIHDLPLFTETSPTSAPWDPLPGPPPVLPHSPHSH L


    Database link: Q9NRG9

  • Positive control

    • HeLa, 293T, Jurkat, TCMK1 and NIH 3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab192911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 60 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Relevance

    Adracalin (AAAS) is expressed in both neuroendocrine and cerebral structures and may function in the normal development of the peripheral and central nervous system. It localizes to nuclear pore complexes (NPCs), large multiprotein assemblies that are the sole sites of nucleocytoplasmic transport. Defects in AAAS are the cause of achalasia-addisonianism-alacrima syndrome (AAA syndrome); also known as triple-A syndrome or Allgrove syndrome.
  • Cellular localization

    nuclear pore
  • Database links

  • Alternative names

    • AAA antibody
    • AAAS antibody
    • AAASb antibody
    • Achalasia adrenocortical insufficiency alacrimia (Allgrove triple A) antibody
    • Achalasia adrenocortical insufficiency alacrimia antibody
    • ADRACALA antibody
    • ADRACALIN antibody
    • Aladin antibody
    • Allgrove triple A antibody
    • DKFZp586G1624 antibody
    • GL003 antibody
    see all

Images

  • All lanes : Anti-Adracalin antibody - C-terminal (ab192911) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 60 kDa


    Exposure time: 30 seconds


    Lysates prepared using NETN lysis buffer.

  • Detection of Adracalin by Western Blot of Immunprecipitate.
    Lane 1: ab192911 at 1 µg/ml labeling Adracalin in 293T whole cell lysate immunoprecipitated using ab192911 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded).
    Lane 2: Control IgG.
    Detection: Chemiluminescence with exposure time of 30 seconds.

References

ab192911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up