Adrenomedullin (1-52) (human), vasodilating peptide (ab142705)
Key features and details
- Potent endogenous vasodilating peptide
- CAS Number: 148498-78-6
- Purity: > 95%
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Adrenomedullin (1-52) (human), vasodilating peptide -
Description
Potent endogenous vasodilating peptide -
Biological description
Potent endogenous vasodilating peptide in the calcitonin (Asc 2264) family. Cleaves into bioactive fragments 13-52 (Asc 2706) and 22-52 (Asc 2707). Increases intracellular cAMP (Asc 493) and NO after binding to the adrenomedullin receptor. Shows modulatory effects on electrolyte balance, neurotransmission, growth, and hormone secretion regulation in vivo. -
Purity
> 95% -
CAS Number
148498-78-6 -
Chemical structure
Properties
-
Molecular weight
6028.90 -
Molecular formula
C264H406N80O77S3 -
Sequence
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY (Modifications: C-terminal amide) -
PubChem identifier
56841671 -
Storage instructions
Store at +4°C. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab142705 has not yet been referenced specifically in any publications.