Adrenomedullin (22-52) (human), CGRP receptor antagonist (ab142707)
- Datasheet
- References
Overview
-
Product name
Adrenomedullin (22-52) (human), CGRP receptor antagonist -
Description
Selective CGRP receptor antagonist. Potent anti-inflammatory agent. -
Biological description
Selective CGRP receptor antagonist. Potent anti-inflammatory agent. Truncated peptide derived from adrenomedullin with no vasoactive effects. Selectively and reversibly antagonizes vasodilator responses to CGRP (Asc 2494) . Increases basal aldosterone secretion in adrenocortical cells. Shows anti-inflammatory and bone protective effects in vivo. -
Purity
> 95% -
CAS Number
159899-65-7 -
Chemical structure
Properties
-
Molecular weight
3576.06 -
Molecular formula
C159H252N46O48 -
Sequence
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY (Modifications: C-terminal amide) -
Storage instructions
Store at +4°C. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
References
This product has been referenced in:
- Li L et al. Adrenomedullin in rat follicles and corpora lutea: expression, functions and interaction with endothelin-1. Reprod Biol Endocrinol 9:111 (2011). Read more (PubMed: 21824440) »
- Kuwasako K et al. Adrenomedullin receptors: pharmacological features and possible pathophysiological roles. Peptides 25:2003-12 (2004). Read more (PubMed: 15501534) »
- Ziolkowska A et al. Effects of adrenomedullin and its fragment 22-52 on basal and ACTH-stimulated secretion of cultured rat adrenocortical cells. Int J Mol Med 11:613-5 (2003). Read more (PubMed: 12684698) »
- Champion HC et al. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am J Physiol 272:R234-42 (1997). Read more (PubMed: 9039014) »