Adrenomedullin (22-52) (human), CGRP receptor antagonist (ab142707)

Overview

  • Product name

    Adrenomedullin (22-52) (human), CGRP receptor antagonist
  • Description

    Selective CGRP receptor antagonist. Potent anti-inflammatory agent.
  • Biological description

    Selective CGRP receptor antagonist. Potent anti-inflammatory agent. Truncated peptide derived from adrenomedullin with no vasoactive effects. Selectively and reversibly antagonizes vasodilator responses to CGRP (Asc 2494) . Increases basal aldosterone secretion in adrenocortical cells. Shows anti-inflammatory and bone protective effects in vivo.
  • Purity

    > 95%
  • CAS Number

    159899-65-7
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    3576.06
  • Molecular formula

    C159H252N46O48
  • Sequence

    TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY (Modifications: C-terminal amide)
  • Storage instructions

    Store at +4°C. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:

  • Li L  et al. Adrenomedullin in rat follicles and corpora lutea: expression, functions and interaction with endothelin-1. Reprod Biol Endocrinol 9:111 (2011). Read more (PubMed: 21824440) »
  • Kuwasako K  et al. Adrenomedullin receptors: pharmacological features and possible pathophysiological roles. Peptides 25:2003-12 (2004). Read more (PubMed: 15501534) »
  • Ziolkowska A  et al. Effects of adrenomedullin and its fragment 22-52 on basal and ACTH-stimulated secretion of cultured rat adrenocortical cells. Int J Mol Med 11:613-5 (2003). Read more (PubMed: 12684698) »
  • Champion HC  et al. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am J Physiol 272:R234-42 (1997). Read more (PubMed: 9039014) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab142707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up