Overview

  • Product name

  • Description

    Rabbit polyclonal to ADRM1/ARM-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human ADRM1/ARM-1 aa 2-407.
    Sequence:

    TTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQ TDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAG SKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSALG GEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPP GSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNG ASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPIL ANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQ LGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEE EDMSLD


    Database link: Q16186

  • Positive control

    • WB: Mouse stomach tissue lysate. IHC-P: Human testis tissue. ICC/IF: MCF7 cells.
  • General notes

     This product was previously labelled as ADRM1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 42 kDa.

Target

  • Function

    Functions as a proteasomal ubiquitin receptor. Recruits the deubiquitinating enzyme UCHL5 at the 26S proteasome and promotes its activity.
  • Sequence similarities

    Belongs to the ADRM1 family.
    Contains 1 PH domain.
  • Domain

    The PH domain mediates interactions with PSMD1 and ubiquitin. Preferential binding to the proximal subunit of K48-linked diubiquitin allows UCHL5 access to the distal subunit.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 110 kDa cell membrane glycoprotein antibody
    • adhesion regulating molecule 1 antibody
    • Adhesion-regulating molecule 1 antibody
    • ADRM 1 antibody
    • Adrm1 antibody
    • ADRM1_HUMAN antibody
    • ARM 1 antibody
    • ARM-1 antibody
    • ARM1 antibody
    • Gp110 antibody
    • hRpn13 antibody
    • M(r) 110,000 surface antigen antibody
    • Proteasomal ubiquitin receptor ADRM1 antibody
    • proteasome regulatory particle non ATPase 13 antibody
    • Proteasome regulatory particle non-ATPase 13 antibody
    • Regulatory particle non ATPase 13 antibody
    • Rpn13 antibody
    • Rpn13 homolog antibody
    see all

Images

  • Anti-ADRM1/ARM-1 antibody (ab236774) at 1/1000 dilution + Mouse stomach tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 42 kDa

  • Paraffin-embedded human testis tissue stained for ADRM1/ARM-1 with ab236774 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (Human breast adenocarcinoma cell line) cells stained for ADRM1/ARM-1 (Green) using ab236774 at 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up