Overview

  • Product name

  • Description

    Rabbit polyclonal to ADX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ADX aa 24-83.
    Sequence:

    WLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFIN RDGETLTTKG


    Database link: P10109

  • Positive control

    • IHC-P: Human adrenal gland tissue; ICC/IF: Human U-2 OS cells.
  • General notes

     This product was previously labelled as Adrenodoxin

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Participates in the synthesis of thyroid hormones. Transfers electrons from adrenodoxin reductase to the cholesterol side chain cleavage cytochrome P450.
  • Sequence similarities

    Belongs to the adrenodoxin/putidaredoxin family.
    Contains 1 2Fe-2S ferredoxin-type domain.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adrenal ferredoxin antibody
    • Adrenodoxin antibody
    • Adrenodoxin, mitochondrial antibody
    • ADX antibody
    • ADX_HUMAN antibody
    • FDX antibody
    • fdx1 antibody
    • Ferredoxin 1 antibody
    • Ferredoxin-1 antibody
    • Hepatoredoxin antibody
    • LOH11CR1D antibody
    • Mitochondrial adrenodoxin antibody
    • mitochondrial antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human adrenal gland tissue labeling ADX with ab204738 at a dilution of 1/200.

  • Immunofluorescent analysis of Human U-2 OS cells labeling ADX with ab204738 at 4 µg/mL.

  • Immunohistochemical analysis of paraffin-embedded human colon tissue labeling ADX with ab204738 at a dilution of 1/200.

  • Immunohistochemical analysis of paraffin-embedded human lymph node tissue labeling ADX with ab204738 at a dilution of 1/200.

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling ADX with ab204738 at a dilution of 1/200.

References

ab204738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up