Overview

  • Product name

  • Description

    Rabbit polyclonal to AEBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AEBP1 aa 289-364.
    Sequence:

    PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEE LKKPKKEDSSPKEETDKWAVEKGKDH


    Database link: Q8IUX7

  • Positive control

    • ICC/IF: U-2 OS (human bone osteosarcoma epithelial cell line) cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    The adipocyte enhancer binding protein 1 is a transcriptional repressor with carboxypeptidase (CP) activity. This protein binds to a regulatory sequence, adipocyte enhancer 1 (AE-1), located in the proximal promoter region of the adipose P2 (aP2) gene, which encodes the adipocyte fatty-acid binding protein. It is characterized as a member of the regulatory B-like CP family. This protein seems to be activated by a novel mechanism, whereby the direct binding of DNA enhances its protease activity. Adipocyte-enhancer binding protein 1 may play a role in differentiated vascular smooth muscle cells.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • ACLP antibody
    • adipocyte enhancer binding protein 1 antibody
    • AE-binding protein 1 antibody
    • aortic carboxypeptidase-like protein antibody

Images

  • PFA fixed/ Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for AEBP1 (green) using ab222147 (4 µg/ml) in Immunocytochemistry/ Immunofluorescence.

References

ab222147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up