Overview

  • Product name

    Anti-AFAF/Equatorin antibody
    See all AFAF/Equatorin primary antibodies
  • Description

    Rabbit polyclonal to AFAF/Equatorin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AFAF/Equatorin aa 215-294.
    Sequence:

    SCESQYSVNPELATMSYFHPSEGVSDTSFSKSAESSTFLGTTSSDMRRSG TRTSESKIMTDIISIGSDNEMHENDESVTR

  • Positive control

    • Human testis tissue
  • General notes

     This product was previously labelled as AFAF

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

  • Function

    Involved in acrosome biogenesis.
  • Tissue specificity

    Isoform 1 is highly expressed in testis. Isoform 2 is expressed at low levels in skin and blood.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > acrosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acrosome formation-associated factor antibody
    • Afaf antibody
    • AFAF_HUMAN antibody
    • C9orf11 antibody
    • chromosome 9 open reading frame 11 antibody
    • equatorin antibody
    see all

Images

  • Immunofluorescent staining of Human cell line U-251MG shows positivity in nucleus but not nucleoli and vesicles. Recommended concentration of ab121461 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab121461 at a 1/300 dilution staining AFAF/Equatorin in Human testis tissue (paraffin embedded) by immunohistochemistry.

References

This product has been referenced in:

  • Yuan Y  et al. Generation of fertile offspring from Kit(w)/Kit(wv) mice through differentiation of gene corrected nuclear transfer embryonic stem cells. Cell Res 25:851-63 (2015). IHC-P . Read more (PubMed: 26088417) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up