Overview

  • Product name

    Anti-AFF2 antibody
  • Description

    Rabbit polyclonal to AFF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human AFF2 aa 715-855.
    Sequence:

    SSTSDSNTDQEETLQIKVLPPCIISGGNTAKSKEICGASLTLSTLMSSSG SNNNLSISNEEPTFSPIPVMQTEILSPLRDHENLKNLWVKIDLDLLSRVP GHSSLHAAPAKPDHKETATKPKRQTAVTAVEKPAPKGKRKH


    Database link: P51816

  • Positive control

    • IHC-P: Human hippocampus tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    RNA-binding protein. Might be involved in alternative splicing regulation through an interaction with G-quartet RNA structure.
  • Tissue specificity

    Brain (most abundant in hippocampus and amygdala), placenta and lung.
  • Involvement in disease

    Mental retardation, X-linked, associated with fragile site FRAXE
  • Sequence similarities

    Belongs to the AF4 family.
  • Cellular localization

    Nucleus speckle. When splicing is inhibited, accumulates in enlarged speckles.
  • Information by UniProt
  • Database links

  • Alternative names

    • AF4/FMR2 family member 2 antibody
    • AF4/FMR2 family, member 2 antibody
    • AFF2 antibody
    • AFF2_HUMAN antibody
    • FMR2 antibody
    • FMR2P antibody
    • Fragile X E mental retardation syndrome protein antibody
    • fragile X mental retardation 2 antibody
    • Fragile X mental retardation 2 protein antibody
    • fragile X mental retardation gene associated with FRAXE antibody
    • FRAXE antibody
    • mild or borderline mental retardation antibody
    • MRX2 antibody
    • OTTHUMP00000024204 antibody
    • OX19 antibody
    • Protein FMR-2 antibody
    • Protein Ox19 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human hippocampus tissue stained for AFF2 with ab243387 at 1/20 dilution in immunohistochemical analysis.

References

ab243387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up