Anti-AFF4 antibody (ab220039)
Key features and details
- Rabbit polyclonal to AFF4
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-AFF4 antibody
See all AFF4 primary antibodies -
Description
Rabbit polyclonal to AFF4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human AFF4 aa 56-199.
Sequence:LGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQS SKWTPVGPAPSTSQSQKRSSGLQSGHSSQRTSAGSSSGTNSSGQRHDRES YNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSLNSSHSRSHG
Database link: Q9UHB7 -
Positive control
- WB: U-251 MG cell lysate. ICC/IF: CACO-2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220039 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 127 kDa. | |
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Relevance
May play a role in transcriptional regulation. Component of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor b (P-TEFb). -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 27125 Human
- Entrez Gene: 93736 Mouse
- Omim: 604417 Human
- SwissProt: Q9UHB7 Human
- SwissProt: Q9ESC8 Mouse
- Unigene: 519313 Human
- Unigene: 395281 Mouse
-
Alternative names
- AF4/FMR2 family member 4 antibody
- AF5Q31 antibody
- Alf4 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-AFF4 antibody (ab220039)
Immunofluorescent analysis of formalin fixed, triton X-100 permeabilized CACO-2 cells labeling AFF4 using ab220039 at 4 μg/ml (green).
-
Western blot - Anti-AFF4 antibody (ab220039)All lanes : Anti-AFF4 antibody (ab220039) at 1/100 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Predicted band size: 127 kDa
Protocols
Datasheets and documents
References (0)
ab220039 has not yet been referenced specifically in any publications.
