Overview

  • Product name

  • Description

    Rabbit polyclonal to AFF4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human AFF4 aa 509-640.
    Sequence:

    QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQ RRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGS RKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS


    Database link: Q9UHB7

  • Positive control

    • IHC-P: Human hippocampus tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    May play a role in transcriptional regulation. Component of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor b (P-TEFb).
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • AF4/FMR2 family member 4 antibody
    • AF5Q31 antibody
    • Alf4 antibody
    • ALL1 fused gene from chromosome 5q31 antibody
    • CHOPS antibody
    • HSPC092 antibody
    • Laf4 antibody
    • Lymphoid nuclear protein related to AF4 like antibody
    • Major CDK9 elongation factor associated protein antibody
    • MCEF antibody
    • MGC107469 antibody
    • RP23-226J16.7 antibody
    see all

Images

  • Paraffin-embedded human hippocampus tissue stained for AFF4 using ab223790 at 1/20 dilution in immunohistochemical analysis.

References

ab223790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up