Overview

  • Product name

  • Description

    Rabbit polyclonal to AGA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse AGA aa 24-260.
    Sequence:

    SSPLPLVVNTWPFKNATEAAWWTLLSGGSALDAVENGCAVCEKEQCDGTV GFGGSPDEGGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARRVLEHTT HTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSDWLSRNCQPNYWRNVIP DPSKYCGPYKPSGFLKQSISPHKEEVDIHSHDTIGMVVIHKTGHTAAGTS TNGIKFKIPGRVGDSPIPGAGAYADDTAGAAAATGDG


    Database link: Q64191

  • Positive control

    • WB: Recombinant mouse AGA; mouse kidney and placenta lysates. IHC-P: Mouse heart and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.
  • Involvement in disease

    Defects in AGA are the cause of aspartylglucosaminuria (AGU) [MIM:208400]. AGU is an inborn lysosomal storage disease. Clinical features of AGU include mild to severe mental retardation manifesting from the age of 2, coarse facial features and mild connective tissue abnormalities. This recessively inherited disease is overrepresented in the Finnish population.
  • Sequence similarities

    Belongs to the Ntn-hydrolase family.
  • Cellular localization

    Lysosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aga antibody
    • AGU antibody
    • Aspartylglucosaminidase antibody
    • Aspartylglucosylamine deaspartylase antibody
    • Aspartylglycosaminuria antibody
    • ASPG_HUMAN antibody
    • ASRG antibody
    • GA antibody
    • Glycosylasparaginase antibody
    • Glycosylasparaginase beta chain antibody
    • N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase antibody
    • N4 (N acetyl beta glucosaminyl) L asparagine amidase antibody
    • N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for AGA with ab230983 at 10 μg/ml in immunohistochemical analysis.

  • All lanes : Anti-AGA antibody (ab230983) at 1 µg

    Lane 1 : Mouse kidney tissue lysate
    Lane 2 : Mouse placenta tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 37 kDa
    Observed band size: 38 kDa
    why is the actual band size different from the predicted?

  • Formalin-fixed, paraffin-embedded mouse heart tissue stained for AGA with ab230983 at 20 μg/ml in immunohistochemical analysis.

  • Anti-AGA antibody (ab230983) at 1 µg/ml + Recombinant mouse AGA

    Developed using the ECL technique.

    Predicted band size: 37 kDa

References

ab230983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up