Overview

  • Product name

  • Description

    Rabbit polyclonal to AGA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human AGA aa 28-245. Expressed in E. coli.
    Sequence:

    PLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSVGFGG SPDELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLEHTTHTLL VGESATTFAQSMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSK YCGPYKPPGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHIAAGTSTNGI KFKIHGRVGDSPIPGAGA


    Database link: P20933

  • Positive control

    • WB: HEK-293T cell lysate. IHC-P: Human cerebellum, glioma, liver, prostate, breast cancer and skin cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.05% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.
  • Involvement in disease

    Defects in AGA are the cause of aspartylglucosaminuria (AGU) [MIM:208400]. AGU is an inborn lysosomal storage disease. Clinical features of AGU include mild to severe mental retardation manifesting from the age of 2, coarse facial features and mild connective tissue abnormalities. This recessively inherited disease is overrepresented in the Finnish population.
  • Sequence similarities

    Belongs to the Ntn-hydrolase family.
  • Cellular localization

    Lysosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aga antibody
    • AGU antibody
    • Aspartylglucosaminidase antibody
    • Aspartylglucosylamine deaspartylase antibody
    • Aspartylglycosaminuria antibody
    • ASPG_HUMAN antibody
    • ASRG antibody
    • GA antibody
    • Glycosylasparaginase antibody
    • Glycosylasparaginase beta chain antibody
    • N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase antibody
    • N4 (N acetyl beta glucosaminyl) L asparagine amidase antibody
    • N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase antibody
    see all

Images

  • Anti-AGA antibody (ab231021) at 1 µg/ml + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen)

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for AGA with ab231021 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for AGA with ab231021 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate gland tissue stained for AGA with ab231021 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for AGA with ab231021 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for AGA with ab231021 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebellum tissue stained for AGA with ab231021 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-AGA antibody (ab231021) at 1 µg/ml + Recombinant human AGA

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

References

ab231021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up