Overview

  • Product name

    Anti-AGGF1 antibody
  • Description

    Rabbit polyclonal to AGGF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human AGGF1 aa 492-537 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TKCDPYVLEHGDEVKIGETVLSFHIHPGSDTCDGCEPGQVRAHLRL


    Database link: Q8N302

  • Positive control

    • Mouse liver and intestine tissue lysates
  • General notes

     This product was previously labelled as VG5Q

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

WB 1/100 - 1/1000. Predicted molecular weight: 81 kDa.

Target

  • Function

    Promotes angiogenesis and the proliferation of endothelial cells. Able to bind to endothelial cells and promote cell proliferation, suggesting that it may act in an autocrine fashion.
  • Tissue specificity

    Widely expressed. Expressed in endothelial cells, vascular smooth muscle cells and osteoblasts. Expressed in umbilical vein endothelial cells and microvascular endothelial cells.
  • Involvement in disease

    Defects in AGGF1 are a cause of Klippel-Trenaunay syndrome (KTS) [MIM:149000]. KTS is a congenital disease characterized by malformations of capillary (98% of KTS patients), venous (72%) and lymphatic (11%) vessels, and bony and soft tissue hypertrophy that leads to large cutaneous hemangiomata with hypertrophy of the related bones and soft tissues.
  • Sequence similarities

    Contains 1 FHA domain.
    Contains 1 G-patch domain.
  • Cellular localization

    Cytoplasm. Secreted. Cytoplasmic in microvascular endothelial cells. Upon angiogenesis, when endothelial cell tube formation is initiated, it is secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AGGF 1 antibody
    • Aggf1 antibody
    • AGGF1_HUMAN antibody
    • Angiogenic factor VG5Q antibody
    • Angiogenic factor with G patch and FHA domains 1 antibody
    • G patch domain containing protein 7 antibody
    • G patch domain-containing protein 7 antibody
    • GPATC 7 antibody
    • GPATC7 antibody
    • GPATCH 7 antibody
    • GPATCH7 antibody
    • HSU84971 antibody
    • HUS84971 antibody
    • hVG5Q antibody
    • Vasculogenesis gene on 5q antibody
    • Vasculogenesis gene on 5q protein antibody
    • VG5Q antibody
    see all

Images

  • All lanes : Anti-AGGF1 antibody (ab203680) at 1/200 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse intestine tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 81 kDa



    12% SDS PAGE

References

This product has been referenced in:

  • Tu J  et al. High expression of angiogenic factor AGGF1 is an independent prognostic factor for hepatocellular carcinoma. Oncotarget 8:111623-111630 (2017). Read more (PubMed: 29340079) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up