Overview

  • Product name

  • Description

    Rabbit polyclonal to AGMAT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human AGMAT aa 53-151. N-terminal His-tag and GST-tags. (Expressed in E.coli).
    Sequence:

    PVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESV MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAA


    Database link: Q9BSE5

  • Positive control

    • WB: Recombinant human AGMAT; HepG2 whole cell lysate; human liver and porcine kidney tissue lysate. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 38 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    AGMAT (Agmatinase) hydrolyzes agmatine to putrescine and urea. It is highly expressed in liver and kidney and is also found in skeletal muscle, fetal liver, brain, testis, skin and the gastrointestinal tract.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • 5033405N08Rik antibody
    • Agmatinase antibody
    • Agmatinase mitochondrial antibody
    • Agmatine ureohydrolase antibody
    • AUH antibody
    • FLJ23384 antibody
    • OTTMUSP00000010524 antibody
    • RP23-395H4.1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for AGMAT using ab231894 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-AGMAT antibody (ab231894) at 1 µg/ml + Recombinant human AGMAT protein

    Developed using the ECL technique.

    Predicted band size: 38 kDa
    Observed band size: 17 kDa
    why is the actual band size different from the predicted?

  • Anti-AGMAT antibody (ab231894) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 38 kDa

  • Anti-AGMAT antibody (ab231894) at 1 µg/ml + Porcine kidney tissue lysate

    Developed using the ECL technique.

    Predicted band size: 38 kDa

  • Anti-AGMAT antibody (ab231894) at 1 µg/ml + Human liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 38 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for AGMAT using ab231894 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up