Overview

  • Product name

  • Description

    Rabbit polyclonal to AGPAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Cow
  • Immunogen

    Recombinant fragment corresponding to Human AGPAT1 aa 227-280.
    Sequence:

    GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYL KKPG


    Database link: Q99943

  • Positive control

    • U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    AGPAT1 converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • 1 acyl sn glycerol 3 phosphate acyltransferase alpha antibody
    • 1 acylglycerol 3 phosphate O acyltransferase 1 (acetoacetly Coenzyme A thiolase) antibody
    • 1 acylglycerol 3 phosphate O acyltransferase 1 (lysophosphatidic acid acyltransferase alpha) antibody
    • 1 acylglycerol 3 phosphate O acyltransferase 1 antibody
    • 1 AGP acyltransferase 1 antibody
    • 1 AGPAT1 antibody
    • AGPAT 1 antibody
    • G15 antibody
    • LPAAT alpha antibody
    • LPAATA antibody
    • Lysophosphatidic acid acyltransferase alpha antibody
    • Lysophospholipid acyltransferase antibody
    • MGC4007 antibody
    • MGC5423 antibody
    • OTTHUMP00000062693 antibody
    • Protein G15 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling AGPAT1 with ab220625 at 4 µg/mL (green).

References

ab220625 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up