Overview

  • Product name

  • Description

    Rabbit polyclonal to AGPAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AGPAT1 aa 204-283.
    Sequence:

    PIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADR VRHSMLTVFREISTDGRGGGDYLKKPGGGG


    Database link: Q99943

  • Positive control

    • WB: K562 whole cell lysate. IHC-P: Human kidney and placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    AGPAT1 converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • 1 acyl sn glycerol 3 phosphate acyltransferase alpha antibody
    • 1 acylglycerol 3 phosphate O acyltransferase 1 (acetoacetly Coenzyme A thiolase) antibody
    • 1 acylglycerol 3 phosphate O acyltransferase 1 (lysophosphatidic acid acyltransferase alpha) antibody
    • 1 acylglycerol 3 phosphate O acyltransferase 1 antibody
    • 1 AGP acyltransferase 1 antibody
    • 1 AGPAT1 antibody
    • AGPAT 1 antibody
    • G15 antibody
    • LPAAT alpha antibody
    • LPAATA antibody
    • Lysophosphatidic acid acyltransferase alpha antibody
    • Lysophospholipid acyltransferase antibody
    • MGC4007 antibody
    • MGC5423 antibody
    • OTTHUMP00000062693 antibody
    • Protein G15 antibody
    see all

Images

  • Anti-AGPAT1 antibody (ab235328) at 1/200 dilution + K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human kidney tissue stained for AGPAT1 with ab235328 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for AGPAT1 with ab235328 at 1/100 dilution in immunohistochemical analysis.

References

ab235328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up