Anti-Agpat2 antibody (ab172505)
Key features and details
- Mouse polyclonal to Agpat2
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Agpat2 antibody
See all Agpat2 primary antibodies -
Description
Mouse polyclonal to Agpat2 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Full length protein corresponding to Human Agpat2 aa 1-278. (NP_006403.2).
Sequence:MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLL RHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQS ILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINRQRSSTAM TVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVPIV PVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHR AMRTTFLHISKTPQENGATAGSGVQPAQ
Database link: O15120 -
Positive control
- AGPAT2 transfected 293T lysate
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab172505 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. |
Target
-
Function
Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. -
Tissue specificity
Expressed predominantly in heart and liver. -
Pathway
Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3. -
Involvement in disease
Defects in AGPAT2 are the cause of congenital generalized lipodystrophy type 1 (CGL1) [MIM:608594]; also known as Berardinelli-Seip congenital lipodystrophy type 1 (BSCL1) or Berardinelli-Seip syndrome. CGL1 is an autosomal recessive disorder characterized by marked paucity of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes. -
Sequence similarities
Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. -
Domain
The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 10555 Human
- Omim: 603100 Human
- SwissProt: O15120 Human
- Unigene: 320151 Human
-
Alternative names
- 1 acyl sn glycerol 3 phosphate acyltransferase beta antibody
- 1 acylglycerol 3 phosphate O acyltransferase 2 antibody
- 1 AGP acyltransferase 2 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab172505 has not yet been referenced specifically in any publications.