Overview

  • Product name

  • Description

    Rabbit polyclonal to AGPAT5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human AGPAT5 aa 174-313.
    Sequence:

    GTRYNPEQTKVLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDCMKNYLD AIYDVTVVYEGKDDGGQRRESPTMTEFLCKECPKIHIHIDRIDKKDVPEE QEHMRRWLHERFEIKDKMLIEFYESPDPERRKRFPGKSVN


    Database link: Q9NUQ2

  • Positive control

    • WB: Mouse brain tissue lysate. IHC-P: Human pancreas and endometrial cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 42 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
  • Pathway

    Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.
  • Sequence similarities

    Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
  • Domain

    The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1 acyl sn glycerol 3 phosphate acyltransferase epsilon antibody
    • 1 acylglycerol 3 phosphate O acyltransferase 5 antibody
    • 1 AGP acyltransferase 5 antibody
    • 1 AGPAT 5 antibody
    • 1 AGPAT5 antibody
    • 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon antibody
    • 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) antibody
    • 1-acylglycerol-3-phosphate O-acyltransferase 5 antibody
    • 1-AGP acyltransferase 5 antibody
    • 1-AGPAT 5 antibody
    • 1acylglycerol3phosphate Oacyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) antibody
    • 1acylglycerol3phosphate Oacyltransferase 5 antibody
    • 1acylglycerol3phosphate Oacyltransferase5 (lysophosphatidic acid acyltransferase, epsilon) antibody
    • 1AGP acyltransferase 5 antibody
    • 1AGPAT5 antibody
    • AGPAT5 antibody
    • LPAAT e antibody
    • LPAAT epsilon antibody
    • LPAAT-epsilon antibody
    • LPAATE antibody
    • Lysophosphatidic acid acyltransferase epsilon antibody
    • PLCE_HUMAN antibody
    see all

Images

  • Paraffin-embedded human endometrial cancer tissue stained for AGPAT5 using ab236541 at 1/100 dilution in immunohistochemical analysis.

  • Anti-AGPAT5 antibody (ab236541) at 1/500 dilution + Mouse brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 42 kDa

  • Paraffin-embedded human pancreas tissue stained for AGPAT5 using ab236541 at 1/100 dilution in immunohistochemical analysis.

References

ab236541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up