Overview

  • Product name

  • Description

    Rabbit polyclonal to AGPS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Guinea pig
  • Immunogen

    Recombinant fragment corresponding to Human AGPS aa 279-400.
    Sequence:

    EAGITGQELERQLKESGYCTGHEPDSLEFSTVGGWVSTRASGMKKNIYGN IEDLVVHIKMVTPRGIIEKSCQGPRMSTGPDIHHFIMGSEGTLGVITEAT IKIRPVPEYQKYGSVAFPNFEQ


    Database link: O00116

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human pancreatic cancer tissue. ICC/IF: NIH/3T3 cells.
  • General notes

     This product was previously labelled as Alkyl-DHAP synthase

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 73 kDa.
IHC-P 1/500 - 1/1000.
ICC/IF 1/50 - 1/200.

Target

  • Pathway

    Glycerolipid metabolism; ether lipid biosynthesis.
  • Involvement in disease

    Defects in AGPS are the cause of rhizomelic chondrodysplasia punctata type 3 (RCDP3) [MIM:600121]. RCDP3 is characterized by rhizomelic shortening of femur and humerus, vertebral disorders, cataract, cutaneous lesions and severe mental retardation.
  • Sequence similarities

    Belongs to the FAD-binding oxidoreductase/transferase type 4 family.
    Contains 1 FAD-binding PCMH-type domain.
  • Cellular localization

    Peroxisome membrane. Localized to the inner aspect of the peroxisomal membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AAG5 antibody
    • ADAP-S antibody
    • ADAS antibody
    • ADAS_HUMAN antibody
    • ADHAPS antibody
    • ADPS antibody
    • Aging associated gene 5 protein antibody
    • Aging-associated gene 5 protein antibody
    • aging-associated protein 5 antibody
    • AGPS antibody
    • ALDHPSY antibody
    • Alkyl-DHAP synthase antibody
    • Alkyldihydroxyacetonephosphate synthase antibody
    • Alkyldihydroxyacetonephosphate synthase, peroxisomal antibody
    • Alkylglycerone phosphate synthase antibody
    • Alkylglycerone-phosphate synthase antibody
    • peroxisomal antibody
    • RCDP3 antibody
    see all

Images

  • Anti-AGPS antibody (ab236621) at 1/500 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 73 kDa

  • Paraffin-embedded human pancreatic cancer tissue stained for AGPS with ab236621 at a 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • NIH/3T3 (Mouse embryo fibroblast cell line) cells stained for AGPS using ab236621 at a dilution of 1/166 in ICC/IF.
    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up