Overview

  • Product name

  • Description

    Guinea pig polyclonal to AGRP
  • Host species

    Guinea pig
  • Tested applications

    Suitable for: IHC-Frmore details
  • Species reactivity

    Reacts with: Rat, Sheep
    Predicted to work with: Mouse, Cow, Human, Pig
  • Immunogen

    Synthetic peptide corresponding to Mouse AGRP aa 82-131.
    Sequence:

    SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT


    Database link: P56473

  • Positive control

    • IHC-Fr: Sheep hypothalamus tissue; rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab228495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/1000 - 1/2000.

Permeabilization suggested: 0.1% Triton X-100 in blocking buffer.

Target

  • Function

    Plays a role in weight homeostasis. Plays a role in the central control of feeding. Reduces food intake. Inhibits cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Acts primarily on MC3R and MC4R. Has very low activity with MC5R.
  • Tissue specificity

    Expressed primarily in the adrenal gland, subthalamic nucleus, and hypothalamus, with a lower level of expression occurring in testis, lung, and kidney.
  • Involvement in disease

    Genetic variations in AGRP may be a cause of obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
  • Sequence similarities

    Contains 1 agouti domain.
  • Domain

    The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.
  • Cellular localization

    Secreted. Golgi apparatus lumen.
  • Information by UniProt
  • Database links

  • Alternative names

    • Agouti related neuropeptide antibody
    • Agouti Related Protein Homolog antibody
    • Agouti-related protein antibody
    • Agrp antibody
    • AGRP_HUMAN antibody
    • AGRT antibody
    • ART antibody
    • ASIP2 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, frozen section of sheep hypothalamus tissue stained for AGRP using ab228495 at 1/1000 dilution in immunohistochemical analysis, followed by detection with a biotinylated secondary antibody.

  • 4% paraformaldehyde-fixed, frozen section of rat brain tissue stained for AGRP using ab228495 at 1/1000 dilution in immunohistochemical analysis, followed by detection with Alexa Fluor® 568 Goat anti-Guinea pig  at 1/500 dilution.

References

This product has been referenced in:

  • Prezotto LD  et al. Influences of maternal nutrient restriction and arginine supplementation on visceral metabolism and hypothalamic circuitry of offspring. Domest Anim Endocrinol 65:71-79 (2018). Read more (PubMed: 30007131) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up