Overview

  • Product name

  • Description

    Rabbit polyclonal to AGXT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human AGXT aa 308-392.
    Sequence:

    QLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGK VLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL


    Database link: P21549

  • Positive control

    • IHC-P: Human liver, testis, colon and cerebral cortex tissues. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Tissue specificity

    Liver.
  • Involvement in disease

    Defects in AGXT are the cause of hyperoxaluria primary type 1 (HP1) [MIM:259900]; also known as primary hyperoxaluria type I (PH1) and oxalosis I. HP1 is a rare autosomal recessive inborn error of glyoxylate metabolism characterized by increased excretion of oxalate and glycolate, and the progressive accumulation of insoluble calcium oxalate in the kidney and urinary tract.
  • Sequence similarities

    Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Peroxisome. Mitochondrion matrix. Except in some HP1 patients where AGT is found in the mitochondrial matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • AGT antibody
    • AGT1 antibody
    • Agxt antibody
    • AGXT1 antibody
    • Alanine glyoxylate aminotransferase antibody
    • Alanine glyoxylate aminotransferase3 antibody
    • Alanine--glyoxylate aminotransferase antibody
    • EC 2.6.1.44 antibody
    • EC 2.6.1.51 antibody
    • Hepatic peroxisomal alanine glyoxylate aminotransferase antibody
    • Hepatic peroxisomal alanine:glyoxylate aminotransferase antibody
    • L alanine glyoxylate aminotransferase 1 antibody
    • MS773 antibody
    • PH1 antibody
    • Serine pyruvate aminotransferase antibody
    • Serine--pyruvate aminotransferase antibody
    • Serine--pyruvate aminotransferase, mitochondrial antibody
    • Serine:pyruvate aminotransferase antibody
    • SPAT antibody
    • SPT antibody
    • SPYA_HUMAN antibody
    • TLH6 antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for AGXT using ab244450 at 1/500 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for AGXT (green) using ab244450 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human colon tissue stained for AGXT using ab244450 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for AGXT using ab244450 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human pancreas tissue stained for AGXT using ab244450 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human cerebral cortex tissue stained for AGXT using ab244450 at 1/500 dilution in immunohistochemical analysis.

References

ab244450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up