Overview

  • Product name

  • Description

    Rabbit polyclonal to AGXT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human AGXT2 aa 259-514. Expressed in E.coli.
    Sequence:

    CQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPKGFLKEAFE LVRARGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPM AAVITTPEIAKSLAKCLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQ EVGTYMLLKFAKLRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVN QIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQH MERRAK


    Database link: Q9BYV1

  • Positive control

    • WB: Recombinant human AGXT2; Porcine liver and kidney tissue lysate. IHC-P: Human liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/400. Predicted molecular weight: 57 kDa.
IHC-P 1/10 - 1/100.

Target

  • Relevance

    AGXT2 is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • (R)-3-amino-2-methylpropionate--pyruvate transaminase antibody
    • AGT2 antibody
    • AI303810 antibody
    • AI663818 antibody
    • Alanine glyoxylate aminotransferase 2 antibody
    • Alanine glyoxylate aminotransferase 2 mitochondrial antibody
    • Beta-ALAAT II antibody
    • Beta-alanine-pyruvate aminotransferase antibody
    • DAIBAT antibody
    see all

Images

  • Formalin-fixed, paraffin- embedded human liver tissue stained for AGXT2 using ab231815 at 1/10 dilution in immunohistochemical analysis. DAB staining.

  • Anti-AGXT2 antibody (ab231815) at 1 µg/ml + Recombinant human AGXT2 protein.

    Developed using the ECL technique.

    Predicted band size: 57 kDa
    Observed band size: 37 kDa
    why is the actual band size different from the predicted?

  • Anti-AGXT2 antibody (ab231815) at 1 µg/ml + Porcinr liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 57 kDa

  • Anti-AGXT2 antibody (ab231815) at 1 µg/ml + Porcine kidney tissue lysate

    Developed using the ECL technique.

    Predicted band size: 57 kDa

References

ab231815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up