Overview

  • Product name

  • Description

    Rabbit polyclonal to AGXT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse AGXT2 aa 226-513. Expressed in E.coli. N-terminal tags.
    Sequence:

    MCPDVFRGPWGGIHCRDSPVQTVRDCSCAPDCCQAKERYIEQFKDTLNTS VATSIAGFFAEPIQGVNGVVQYPKEFLKEAFALVRERGGVCIADEVQTGF GRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAAVVTTPEIAKSLAKRLL HFSTFGGNPLACAIGSAVLEVIEEENLQRNSQEVGTYMLLKFAKLRDEFD IVGDVRGKGLMVGIEMVQDKISRQPLPKTEVNQIHEDCKDMGLLVGRGGN FSQTFRIVPPMCVTKMEVDFAYEVFRAALIQHMERRAK


    Database link: Q3UEG6

  • Positive control

    • IHC-P: Mouse liver tissue. WB: Mouse liver and kidney lysate; Recombinant mouse AGXT2 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232803 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 57 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    AGXT2 is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • (R)-3-amino-2-methylpropionate--pyruvate transaminase antibody
    • AGT2 antibody
    • AI303810 antibody
    • AI663818 antibody
    • Alanine glyoxylate aminotransferase 2 antibody
    • Alanine glyoxylate aminotransferase 2 mitochondrial antibody
    • Beta-ALAAT II antibody
    • Beta-alanine-pyruvate aminotransferase antibody
    • DAIBAT antibody
    see all

Images

  • Anti-AGXT2 antibody (ab232803) at 2 µg/ml + Mouse kidney lysate

    Predicted band size: 57 kDa

  • Paraffin-embedded mouse liver tissue stained for AGXT2 using ab232803 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-AGXT2 antibody (ab232803) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 57 kDa

  • Anti-AGXT2 antibody (ab232803) at 2 µg/ml + Recombinant mouse AGXT2 protein

    Predicted band size: 57 kDa

References

ab232803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up